KEGG   Methanolobus psychrophilus: Mpsy_1767Help
Entry
Mpsy_1767         CDS       T02280                                 

Definition
pyruvate synthase, gamma subunit
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
mpy  Methanolobus psychrophilus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mpy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mpsy_1767
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpsy_1767
   00020 Citrate cycle (TCA cycle)
    Mpsy_1767
   00620 Pyruvate metabolism
    Mpsy_1767
   00640 Propanoate metabolism
    Mpsy_1767
   00650 Butanoate metabolism
    Mpsy_1767
  Energy metabolism
   00680 Methane metabolism
    Mpsy_1767
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mpsy_1767
Enzymes [BR:mpy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mpsy_1767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1733481..1734026)
Genome map
AA seq 181 aa AA seqDB search
MKEIRIHGRGGQGSVTAAELLAVAAFADSKFSQAFPAFGVERRGAPVQAFTRINDTPIRL
RSQIYKPDYVIVQDPTLLESVDVASGLKDDGILIINSDFDPEKFKLDTKAKIMTVNATKI
ALDIIGMPIVNTVLLGAFAGATGEIRPESIMEAVRERFPGKVGDRNAQAIMEAYKMMEGQ
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaataagaatacacggccggggaggtcagggttcggtcactgctgctgagctt
ctggctgttgctgcttttgcggacagcaagttcagccaggctttcccagctttcggagtg
gaaagaaggggagcacctgtccaggctttcaccaggatcaacgatactccaataagactt
agaagccagatctacaagcctgactatgtgatcgtgcaggacccgacattactggaatct
gtcgatgtggccagtggcctgaaggatgatgggatacttatcattaacagtgactttgat
ccggaaaaattcaagcttgatacaaaggcaaagataatgacagtgaatgctacaaagata
gcactcgatatcattggaatgccaatcgtcaacacagtgctgcttggcgcttttgctggt
gccaccggtgagataagacctgagtccattatggaagcggtcagggaaagattcccgggc
aaagtcggagataggaacgcacaggcgattatggaagcatacaagatgatggagggtcag
aagtga

DBGET integrated database retrieval system