KEGG   Methanolobus psychrophilus: Mpsy_1818Help
Entry
Mpsy_1818         CDS       T02280                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
mpy  Methanolobus psychrophilus
Pathway
mpy00790  Folate biosynthesis
mpy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mpsy_1818
Enzymes [BR:mpy01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Mpsy_1818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: AFV24024
UniProt: K4MFD4
Position
complement(1789215..1790450)
Genome map
AA seq 411 aa AA seqDB search
MVVDVDICGLKIGDEHPVRLMGVINLSKESFYKDSVVSTDSLLDVARKMVDDGATIIDIG
ARSTWPLAKPLVSKEEELQRMLPALDMLKDNVDALISVDTVYSDVAEGSLKHGADIVNDV
SGFTTDLRMMDLVADHSCPAVVMASNEIPGDPIGMDAIMGSLASIIARADSKGIDTNKLI
LDPAIGRWIPEKDPIYDFETIDQFESLKVFGKPLLAAISRKSCIDAVLHKPASERLYGSL
AATAIVVHKGAHIIRTHDVAQTRDVVEVAKAMRSRQSFVQSGNFEISVINITHPDDAEYL
MKGIGVTGTGAKVMKNKTVSKVIRVSNITTTEALIIKQEMLARGGDAALERDAVSHETEK
TDALIIGTLLQFEKVVRKLSYQARNLPLIAEMMAKALEQDMDVEYRYQREL
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggttgttgatgttgatatatgtggcttgaaaattggtgacgagcaccctgtcagattg
atgggtgttatcaacctgagcaaggagtcgttctataaggactctgtggtaagtactgat
tctctccttgatgttgcccggaaaatggtagatgacggcgcaacgataatagatataggg
gcccgctcaacatggcctcttgcaaaaccccttgtcagtaaagaggaggaactgcagcgc
atgttacctgcactggacatgctgaaggataacgtggatgcgcttatttccgtggacact
gtttactctgatgttgcggaaggctccctgaagcatggtgctgatattgttaacgatgtg
tcgggattcaccaccgacctgcgtatgatggatctagtggcagaccactcctgtcccgct
gttgtaatggcatcaaatgagatccccggggacccgataggcatggatgccatcatggga
tcccttgcatccatcattgccagggccgattcaaagggaatagatacgaacaagctcata
ctcgaccctgccattggaaggtggattcctgaaaaagaccccatttatgattttgagacc
atcgaccagttcgagagcctgaaggtttttgggaaaccactgcttgcagctatatccagg
aaatcctgcatcgatgcggtgctgcacaaacccgcaagtgagaggctatatggaagcctt
gcagctacggctattgtcgtacacaagggagctcacatcatacggacccatgatgtcgcg
caaaccagggatgttgtcgaggttgcaaaggcgatgagaagcagacaatcctttgtacaa
tcaggtaattttgagatatccgtcataaacataactcatcctgatgacgctgaatatctt
atgaagggcattggtgtcactggaaccggtgcgaaggtgatgaagaataaaacagtgagc
aaagttatacgtgtcagcaatatcaccaccaccgaggccctgatcatcaagcaggagatg
ctggccagaggaggggatgctgcccttgagcgcgatgccgtatcccatgagaccgaaaag
acggatgcactgatcataggtacactcctgcagttcgagaaagtggtccgcaagctctca
taccaggcacgcaaccttccgctcattgcagagatgatggcaaaggccctggaacaggac
atggacgtggaataccgctaccagagggaactatga

DBGET integrated database retrieval system