KEGG   Methanolobus psychrophilus: Mpsy_1864Help
Entry
Mpsy_1864         CDS       T02280                                 

Definition
acetyl-coenzyme A synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mpy  Methanolobus psychrophilus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Class
Metabolism; Overview; Carbon metabolism [PATH:mpy01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mpy00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mpy00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mpy00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:mpy00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1828650..1830539
Genome map
AA seq 629 aa AA seqDB search
MSENFDVKLSGKSYLPDPSAKENSWIQDYETAYAGFLKDPEKHWESIAEELDWFKKWDHV
REWEHPHAKWFTHAKLNITYNCLDRHIFNGKRNKVAIIWVGDDGKEQVITYRQLYREVMR
FANGLKSLGVGKGDRVCIYMPLVPEQIIAMLACARIGAVHSVVFGGFGSNALHSRIKDAQ
AKIVITADAAIRRGKRIDLKSLVDKAVVNASCVEKIIVLRRMSPPMELFSEIEVDFNDIL
EKEDKECEPEVMDSEDPLFILYTSGTTGPAKGIVHTCGGYMVGTYYTTKCVLDLKDSDVM
WCTADPGWITGHSYIVYGPLSLGATILITEATPDYPDPGIWWSIIEEFDVTVFYTAPTVI
RMFMRQGEQWPQQYNLNSLRILGSVGEPLNPEAFEWYYSVVGKNKCPVLDTWWQTETGMH
MITTTVGEPMKPGFAGRAVPGIVVDVVDENGQPVPPGTGGLLVIKEPWPSMMRTVYGNDE
RYRQYWSTIGNYYTAGDLAVKDEDGYIMILGRSDDVLIVAGHNIGSAEVESALVSHEAVA
EAAVIGKPDPLKGDSIKAFIILCIGYKPSDKLKLDLVYHVRMDLGPIAIPSEIEFVESLP
KTRSGKIMRRVLKARELGMDPGDLSSLDD
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagaattttgatgtaaaactgagcggcaagagttacctgccagatccctctgct
aaagagaattcctggatacaggattatgaaactgcctacgccggatttctcaaggatcct
gaaaagcactgggaaagtattgcagaggagctggattggttcaaaaaatgggaccatgtc
cgtgaatgggagcacccgcatgcaaaatggttcactcatgcaaaactgaatataacctat
aattgcctggaccgccacatcttcaatggtaaaaggaacaaagtcgcaataatatgggtt
ggcgatgatggcaaagagcaggtgatcacatatcggcagctttaccgtgaggtcatgaga
tttgccaatggtctgaagtcactgggcgtgggcaagggagaccgagtctgcatctacatg
cccttggtgcccgagcagataattgccatgctggcatgtgcccgtataggtgcggtacat
agcgttgtgttcggcggttttggctccaatgcactgcattcaaggatcaaggacgcgcag
gcaaagatagtcataactgcagatgcagctataagacgtggcaaacgtatcgatcttaaa
tcccttgttgacaaagctgttgtaaatgcttcctgtgtggaaaagataattgttctcagg
agaatgtcccccccaatggagctcttctcggagatagaggtcgactttaatgacatcctg
gagaaagaggataaggaatgcgaaccggaagtgatggattccgaggacccgctctttata
ctttataccagtggcaccacaggacctgcaaaaggtattgtccatacatgcggtggctat
atggtcggaacatattacaccactaagtgtgtgttagacctgaaagacagcgacgtgatg
tggtgtacggccgacccgggctggatcaccgggcacagctacatagtctatggtcctctt
tctctgggtgctacaatactgataacggaggcaactcctgattatcctgaccccggcatc
tggtggagcatcatagaagagttcgacgtgaccgtcttctacacagcgccgaccgttatt
cgtatgttcatgagacagggtgagcagtggccgcaacaatataacctgaattcccttcgg
atactgggttctgtaggcgagcctctcaacccggaggcttttgagtggtactacagcgtc
gtcggtaagaataaatgccccgtcctggatacctggtggcagacagaaacgggcatgcac
atgatcaccacgactgtaggcgaacccatgaagccgggatttgcaggccgtgccgttccg
ggcattgttgtggacgttgtcgatgagaacggccagcccgtgcctccgggtacaggtggt
cttctggtcattaaggaaccctggccctcaatgatgaggactgtatatggtaatgatgaa
aggtacaggcagtactggagcaccattggcaattattacactgccggtgaccttgctgtg
aaggatgaggacggctatataatgatactgggccgttctgacgatgtccttatagttgct
ggccataacataggcagtgcggaagtggaaagcgcacttgtctcccacgaagccgttgct
gaggcagcggtcataggcaagcccgatcccctcaaaggagattccatcaaagccttcatc
atactttgcataggttacaagcccagcgataaactcaagctggaccttgtatatcatgta
aggatggatctgggtcctatcgccataccttcagagatagaattcgtggaatccctgcca
aagacccgcagtggcaagattatgaggcgggtgctcaaagccagggagcttggcatggat
ccgggagacctttcctctctggacgactga

DBGET integrated database retrieval system