KEGG   Methanolobus psychrophilus: Mpsy_1864Help
Entry
Mpsy_1864         CDS       T02280                                 

Definition
acetyl-coenzyme A synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mpy  Methanolobus psychrophilus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mpy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mpsy_1864
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpsy_1864
   00620 Pyruvate metabolism
    Mpsy_1864
   00640 Propanoate metabolism
    Mpsy_1864
  Energy metabolism
   00680 Methane metabolism
    Mpsy_1864
Enzymes [BR:mpy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mpsy_1864
Lipid biosynthesis proteins [BR:mpy01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mpsy_1864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1828650..1830539
Genome map
AA seq 629 aa AA seqDB search
MSENFDVKLSGKSYLPDPSAKENSWIQDYETAYAGFLKDPEKHWESIAEELDWFKKWDHV
REWEHPHAKWFTHAKLNITYNCLDRHIFNGKRNKVAIIWVGDDGKEQVITYRQLYREVMR
FANGLKSLGVGKGDRVCIYMPLVPEQIIAMLACARIGAVHSVVFGGFGSNALHSRIKDAQ
AKIVITADAAIRRGKRIDLKSLVDKAVVNASCVEKIIVLRRMSPPMELFSEIEVDFNDIL
EKEDKECEPEVMDSEDPLFILYTSGTTGPAKGIVHTCGGYMVGTYYTTKCVLDLKDSDVM
WCTADPGWITGHSYIVYGPLSLGATILITEATPDYPDPGIWWSIIEEFDVTVFYTAPTVI
RMFMRQGEQWPQQYNLNSLRILGSVGEPLNPEAFEWYYSVVGKNKCPVLDTWWQTETGMH
MITTTVGEPMKPGFAGRAVPGIVVDVVDENGQPVPPGTGGLLVIKEPWPSMMRTVYGNDE
RYRQYWSTIGNYYTAGDLAVKDEDGYIMILGRSDDVLIVAGHNIGSAEVESALVSHEAVA
EAAVIGKPDPLKGDSIKAFIILCIGYKPSDKLKLDLVYHVRMDLGPIAIPSEIEFVESLP
KTRSGKIMRRVLKARELGMDPGDLSSLDD
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagaattttgatgtaaaactgagcggcaagagttacctgccagatccctctgct
aaagagaattcctggatacaggattatgaaactgcctacgccggatttctcaaggatcct
gaaaagcactgggaaagtattgcagaggagctggattggttcaaaaaatgggaccatgtc
cgtgaatgggagcacccgcatgcaaaatggttcactcatgcaaaactgaatataacctat
aattgcctggaccgccacatcttcaatggtaaaaggaacaaagtcgcaataatatgggtt
ggcgatgatggcaaagagcaggtgatcacatatcggcagctttaccgtgaggtcatgaga
tttgccaatggtctgaagtcactgggcgtgggcaagggagaccgagtctgcatctacatg
cccttggtgcccgagcagataattgccatgctggcatgtgcccgtataggtgcggtacat
agcgttgtgttcggcggttttggctccaatgcactgcattcaaggatcaaggacgcgcag
gcaaagatagtcataactgcagatgcagctataagacgtggcaaacgtatcgatcttaaa
tcccttgttgacaaagctgttgtaaatgcttcctgtgtggaaaagataattgttctcagg
agaatgtcccccccaatggagctcttctcggagatagaggtcgactttaatgacatcctg
gagaaagaggataaggaatgcgaaccggaagtgatggattccgaggacccgctctttata
ctttataccagtggcaccacaggacctgcaaaaggtattgtccatacatgcggtggctat
atggtcggaacatattacaccactaagtgtgtgttagacctgaaagacagcgacgtgatg
tggtgtacggccgacccgggctggatcaccgggcacagctacatagtctatggtcctctt
tctctgggtgctacaatactgataacggaggcaactcctgattatcctgaccccggcatc
tggtggagcatcatagaagagttcgacgtgaccgtcttctacacagcgccgaccgttatt
cgtatgttcatgagacagggtgagcagtggccgcaacaatataacctgaattcccttcgg
atactgggttctgtaggcgagcctctcaacccggaggcttttgagtggtactacagcgtc
gtcggtaagaataaatgccccgtcctggatacctggtggcagacagaaacgggcatgcac
atgatcaccacgactgtaggcgaacccatgaagccgggatttgcaggccgtgccgttccg
ggcattgttgtggacgttgtcgatgagaacggccagcccgtgcctccgggtacaggtggt
cttctggtcattaaggaaccctggccctcaatgatgaggactgtatatggtaatgatgaa
aggtacaggcagtactggagcaccattggcaattattacactgccggtgaccttgctgtg
aaggatgaggacggctatataatgatactgggccgttctgacgatgtccttatagttgct
ggccataacataggcagtgcggaagtggaaagcgcacttgtctcccacgaagccgttgct
gaggcagcggtcataggcaagcccgatcccctcaaaggagattccatcaaagccttcatc
atactttgcataggttacaagcccagcgataaactcaagctggaccttgtatatcatgta
aggatggatctgggtcctatcgccataccttcagagatagaattcgtggaatccctgcca
aagacccgcagtggcaagattatgaggcgggtgctcaaagccagggagcttggcatggat
ccgggagacctttcctctctggacgactga

  All links  
No link information was found.   
DBGET integrated database retrieval system