KEGG   Methanolobus psychrophilus: Mpsy_2170Help
Entry
Mpsy_2170         CDS       T02280                                 

Definition
ELP3 family histone acetyltransferase
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mpy  Methanolobus psychrophilus
Brite
Enzymes [BR:mpy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Mpsy_2170
Transfer RNA biogenesis [BR:mpy03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Mpsy_2170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2096514..2098160)
Genome map
AA seq 548 aa AA seqDB search
MTAQDTDYNKACRKILELVIDGKITGLRQLNLEKKRTAKSCRLASLPKNADIIMTGNEEE
QGKVRGILQRKPVRTISGVAVIAAMTSPAPCPHGICVPCPGGPDSQFNSPQSYMGREPST
MRAIQHDYDPYRIVTSRLRQLKEIGHEIKKAELIVMGGTFSARSVDYQEWYAKRCIEAMN
DFYGTDWRNNANTIGEACPYVTLEEVHKANETAEVRNTGITFETRPDWTKPEHIDRMLEL
GATKVEIGVQSTYDFVLSRMRRGHTVADSTEANRVLRDSALKVGFHMMPGLPGMDEESEI
RNFKRLFTDPRFMPDYLKIYPTLVTEGTELHKMWEGGSYSAITDEDAVGLLAQIKSLVPK
WVRLQRIQRDIPAPQILAGVRKSNVRQLAQDHLERHGGRCRCIRCREVGHNILKGREPNY
EHIELTVESYDCCGGKEHFIAFEDTAQDILIGFMRLRFPSMPHREELENAALGRELHVYG
SMVAVGDSAGKCDWQHRGYGKELVACAEEISLNAGYTKLAILSGIGVRGYYRKSGYERDG
AYMSRKLE
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgactgcgcaagacactgattataataaagcatgcagaaagatccttgagttggttatc
gacgggaagatcaccggcctgcgccaacttaatttggagaagaagagaacagcaaagagc
tgcaggcttgccagcctcccgaagaatgcagacattattatgacaggcaacgaagaagaa
cagggaaaggtaaggggtatcctgcaacgaaaaccggtacgtaccatatccggggtcgcg
gtcatagcagccatgacgtcccctgcaccctgccctcacggaatatgcgttccctgtccg
ggaggaccggattcgcaattcaattccccccaaagttacatgggaagggagccttccacc
atgcgtgcgatacagcacgactacgacccttacaggatagttacatccaggcttaggcag
ctaaaggagatagggcatgagataaagaaagccgaactcattgtcatgggtggcactttt
tccgcaaggtctgtagactaccaggaatggtatgcgaaacgctgtattgaggcaatgaac
gacttttatggtactgattggcgcaataatgccaatactataggagaggcttgcccctat
gtcaccctggaagaggtacacaaggccaatgagaccgcagaggtgagaaatacaggtatt
acctttgagaccaggccggactggacaaagcctgaacatattgacaggatgctggaactt
ggagctaccaaggtcgagattggcgttcagagtacttatgacttcgtgctctcaagaatg
cgcagggggcatactgttgcagacagcactgaagctaacagagtgctgagagacagtgcc
cttaaggtaggattccacatgatgcccgggcttccaggcatggacgaggaaagcgagata
aggaatttcaaaagactgttcactgacccgagattcatgcctgactatcttaagatttac
cccacgcttgtcacagaaggcacagaactgcataaaatgtgggagggcgggagttatagc
gcgataacagatgaagatgctgtggggcttctagcgcagatcaagtcacttgtaccgaaa
tgggtccgcctgcaacgcatacaaagagatattcctgctccccagatacttgccggagtc
aggaaaagcaacgtgagacagcttgcgcaggaccaccttgagcggcatgggggaaggtgc
cgatgtatcaggtgccgcgaagtaggacataatatcctgaaaggaagagagcccaattac
gaacatatcgagctcacggtcgaaagttatgactgctgcggaggaaaggaacattttatt
gcttttgaggatacggctcaggatatactcataggcttcatgaggctgcgcttcccttcc
atgccacaccgggaagaacttgagaatgctgccctgggaagagagttgcatgtctatggt
tccatggtggctgtgggcgatagcgccggaaagtgtgattggcagcacagagggtatggc
aaggaactagttgcatgtgcagaggagatatccctcaacgcaggttataccaaactggca
atccttagtggcataggcgtgagaggatactaccgtaagtcgggctatgaacgtgacggg
gcatacatgtcaaggaaactggaataa

DBGET integrated database retrieval system