KEGG   Methanolobus psychrophilus: Mpsy_2700Help
Entry
Mpsy_2700         CDS       T02280                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mpy  Methanolobus psychrophilus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mpy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mpsy_2700
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mpsy_2700
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mpsy_2700
Enzymes [BR:mpy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mpsy_2700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2584642..2585940
Genome map
AA seq 432 aa AA seqDB search
MDHTKILLDENDMPKKWYNILADLPVEPPLNPATREPMNPKDLEPIFAKELIKQEMSSER
YITIPEEIREIYKLWRPSPLYRAHRLEKMLGTPAKIYYKNEGVSPAGSHKPNTAIAQAYY
NMKEGTERISTETGAGQWGSALSLSCNYFDIECKVYMVRSSYYQKPYRKSLINLWGATVV
PSPSPDTQFGRKVLEMYPDTTGSLGIAISEAIEDAALNDNTKYALGSVLNHTCLHQTVVG
LETQKQFELTEDYPDIVIGCCGGGSNLAGVSLPYIRDNIEGKTDTRIIAVEPSACPTLTE
GKFEYDFGDMAQMTPLLKMFTLGSSFIPPAIHAGGLRYHGASPIVSKLVADKYMEARSYH
QIEVFDAAVTFARSEGIAPAPESSHAIKAAVDEAIKCKQTGEEKTILFNLSGHGHFDMGS
YDKYFSGELTNE
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggatcatacaaaaatactacttgacgaaaacgacatgccaaagaaatggtataacatc
cttgccgacctgccggtagaaccgcctttgaatccggctaccagggagccaatgaacccc
aaggaccttgagcctatatttgcaaaagagctcatcaaacaggagatgagctccgagaga
tatatcactatcccggaagaaatccgcgagatatacaaactgtggaggccttctccgctg
tacagggcacacaggcttgagaagatgcttggaactcctgcaaagatatattacaagaac
gaaggcgtaagccctgcaggaagccacaagccaaatactgctatagcgcaggcatattac
aatatgaaagagggtaccgaaaggatcagtaccgagactggtgccggacagtggggcagc
gcactgtcgctctcatgcaattatttcgacatcgaatgtaaggtttacatggtgcgctcc
agctactaccagaaaccttacagaaaatccctcatcaatctctggggagcaacagtcgtg
ccatcccccagcccggacacacagtttggaaggaaggtgcttgagatgtatccggacaca
accggcagtctgggtatagccatcagtgaggctatcgaggacgcagctctcaatgacaat
accaagtatgcgcttggaagcgtactgaaccatacatgcctccaccagacagtcgtgggc
ctggagacccagaagcagttcgagctgaccgaagactatccggacatcgtcatcggatgc
tgtggcggaggaagcaacctggctggtgtgagcctgccctacatcagggacaacattgaa
ggtaagactgacacaaggatcatagccgttgagccatcagcatgcccaactctcacggaa
ggtaaatttgagtacgacttcggtgatatggcacagatgacacccctgctcaagatgttc
acacttggatcaagtttcataccacctgccatccacgcaggaggcctgagataccatggc
gcttctcctatagtcagcaaacttgtagctgacaaatacatggaagccaggtcctatcat
cagatagaggtattcgatgcggctgtgacattcgcccgcagcgagggaattgcccctgcc
cctgaatcttcacacgccatcaaagcagctgtggatgaagctatcaaatgcaagcagacc
ggtgaagagaagaccatccttttcaatctcagcggtcacggtcactttgatatgggctcg
tacgataaatatttctcaggcgaactcactaacgagtaa

DBGET integrated database retrieval system