KEGG   Methanolobus psychrophilus: Mpsy_2700Help
Entry
Mpsy_2700         CDS       T02280                                 

Definition
tryptophan synthase subunit beta
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mpy  Methanolobus psychrophilus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mpy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mpsy_2700
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mpsy_2700
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mpsy_2700
Enzymes [BR:mpy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mpsy_2700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2584642..2585940
Genome map
AA seq 432 aa AA seqDB search
MDHTKILLDENDMPKKWYNILADLPVEPPLNPATREPMNPKDLEPIFAKELIKQEMSSER
YITIPEEIREIYKLWRPSPLYRAHRLEKMLGTPAKIYYKNEGVSPAGSHKPNTAIAQAYY
NMKEGTERISTETGAGQWGSALSLSCNYFDIECKVYMVRSSYYQKPYRKSLINLWGATVV
PSPSPDTQFGRKVLEMYPDTTGSLGIAISEAIEDAALNDNTKYALGSVLNHTCLHQTVVG
LETQKQFELTEDYPDIVIGCCGGGSNLAGVSLPYIRDNIEGKTDTRIIAVEPSACPTLTE
GKFEYDFGDMAQMTPLLKMFTLGSSFIPPAIHAGGLRYHGASPIVSKLVADKYMEARSYH
QIEVFDAAVTFARSEGIAPAPESSHAIKAAVDEAIKCKQTGEEKTILFNLSGHGHFDMGS
YDKYFSGELTNE
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggatcatacaaaaatactacttgacgaaaacgacatgccaaagaaatggtataacatc
cttgccgacctgccggtagaaccgcctttgaatccggctaccagggagccaatgaacccc
aaggaccttgagcctatatttgcaaaagagctcatcaaacaggagatgagctccgagaga
tatatcactatcccggaagaaatccgcgagatatacaaactgtggaggccttctccgctg
tacagggcacacaggcttgagaagatgcttggaactcctgcaaagatatattacaagaac
gaaggcgtaagccctgcaggaagccacaagccaaatactgctatagcgcaggcatattac
aatatgaaagagggtaccgaaaggatcagtaccgagactggtgccggacagtggggcagc
gcactgtcgctctcatgcaattatttcgacatcgaatgtaaggtttacatggtgcgctcc
agctactaccagaaaccttacagaaaatccctcatcaatctctggggagcaacagtcgtg
ccatcccccagcccggacacacagtttggaaggaaggtgcttgagatgtatccggacaca
accggcagtctgggtatagccatcagtgaggctatcgaggacgcagctctcaatgacaat
accaagtatgcgcttggaagcgtactgaaccatacatgcctccaccagacagtcgtgggc
ctggagacccagaagcagttcgagctgaccgaagactatccggacatcgtcatcggatgc
tgtggcggaggaagcaacctggctggtgtgagcctgccctacatcagggacaacattgaa
ggtaagactgacacaaggatcatagccgttgagccatcagcatgcccaactctcacggaa
ggtaaatttgagtacgacttcggtgatatggcacagatgacacccctgctcaagatgttc
acacttggatcaagtttcataccacctgccatccacgcaggaggcctgagataccatggc
gcttctcctatagtcagcaaacttgtagctgacaaatacatggaagccaggtcctatcat
cagatagaggtattcgatgcggctgtgacattcgcccgcagcgagggaattgcccctgcc
cctgaatcttcacacgccatcaaagcagctgtggatgaagctatcaaatgcaagcagacc
ggtgaagagaagaccatccttttcaatctcagcggtcacggtcactttgatatgggctcg
tacgataaatatttctcaggcgaactcactaacgagtaa

DBGET integrated database retrieval system