KEGG   Methanolobus psychrophilus: Mpsy_2709Help
Entry
Mpsy_2709         CDS       T02280                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mpy  Methanolobus psychrophilus
Pathway
mpy00860  Porphyrin and chlorophyll metabolism
mpy01100  Metabolic pathways
mpy01110  Biosynthesis of secondary metabolites
mpy01120  Microbial metabolism in diverse environments
Module
mpy_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mpy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mpsy_2709 (hemD)
Enzymes [BR:mpy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Mpsy_2709 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Aa_trans
Motif
Other DBs
NCBI-ProteinID: AFV24910
UniProt: K4MG99
Position
2595310..2596107
Genome map
AA seq 265 aa AA seqDB search
MADNTKKPVITIMRPERYIKESVEMARSMGFDTFTVPMVEITDMKDEFFDGFVERVLDGR
ADYVIFTSANGIDFTISKIPPESRKGFIDALNRTKVIAIGPTTRKALEKTGVNVMGMPGV
YSSEGIVDYLRDDVTGRVVDTARSFYGSEHLVEGLRSCGAVVNQTQVYTLEKPAGNEQDK
LIDATIKGEIAAFAFTSSMMVHNFFEHSRSRASEEQVVNALNNVIVAAIGGPTAQTLSGY
GVKVSVIPEKFVFEEVLKSIKDHLP
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggctgataatactaaaaagccggtaattaccatcatgcggcctgagaggtacatcaag
gaatccgtggagatggccaggtccatgggttttgacacgttcacagtacccatggtagag
ataaccgatatgaaagacgagttctttgatggttttgtggaaagggtacttgacggcagg
gctgattatgtaattttcacaagtgctaatgggatagatttcaccataagcaagatacca
cctgagtccaggaagggctttatagatgctctcaacaggacaaaggtcattgccatcggt
cctaccacccgcaaggcacttgagaagacaggtgtcaatgttatggggatgccgggagtt
tatagttcagaaggtattgttgattaccttcgtgacgatgtgaccggtcgggtagttgat
actgccaggagcttttacggctcggagcatcttgttgaaggcctgcgtagctgcggggcc
gttgtcaaccaaacacaagtctatactctggaaaagccggcggggaacgagcaggataag
cttattgatgccactatcaaaggtgagatcgcagcttttgccttcacaagttccatgatg
gtacataatttctttgaacattcacgttcaagagcttccgaggagcaggtggtcaacgca
ttgaacaatgtcattgttgcagcaataggcggtcccacagcacagaccctcagtgggtat
ggggtaaaggtgtctgtcattcctgaaaaattcgttttcgaggaagtactcaagtcgatc
aaggaccacctcccataa

DBGET integrated database retrieval system