KEGG   Methanolobus psychrophilus: Mpsy_2709Help
Entry
Mpsy_2709         CDS       T02280                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mpy  Methanolobus psychrophilus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mpsy_2709 (hemD)
Enzymes [BR:mpy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Mpsy_2709 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2595310..2596107
Genome map
AA seq 265 aa AA seqDB search
MADNTKKPVITIMRPERYIKESVEMARSMGFDTFTVPMVEITDMKDEFFDGFVERVLDGR
ADYVIFTSANGIDFTISKIPPESRKGFIDALNRTKVIAIGPTTRKALEKTGVNVMGMPGV
YSSEGIVDYLRDDVTGRVVDTARSFYGSEHLVEGLRSCGAVVNQTQVYTLEKPAGNEQDK
LIDATIKGEIAAFAFTSSMMVHNFFEHSRSRASEEQVVNALNNVIVAAIGGPTAQTLSGY
GVKVSVIPEKFVFEEVLKSIKDHLP
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggctgataatactaaaaagccggtaattaccatcatgcggcctgagaggtacatcaag
gaatccgtggagatggccaggtccatgggttttgacacgttcacagtacccatggtagag
ataaccgatatgaaagacgagttctttgatggttttgtggaaagggtacttgacggcagg
gctgattatgtaattttcacaagtgctaatgggatagatttcaccataagcaagatacca
cctgagtccaggaagggctttatagatgctctcaacaggacaaaggtcattgccatcggt
cctaccacccgcaaggcacttgagaagacaggtgtcaatgttatggggatgccgggagtt
tatagttcagaaggtattgttgattaccttcgtgacgatgtgaccggtcgggtagttgat
actgccaggagcttttacggctcggagcatcttgttgaaggcctgcgtagctgcggggcc
gttgtcaaccaaacacaagtctatactctggaaaagccggcggggaacgagcaggataag
cttattgatgccactatcaaaggtgagatcgcagcttttgccttcacaagttccatgatg
gtacataatttctttgaacattcacgttcaagagcttccgaggagcaggtggtcaacgca
ttgaacaatgtcattgttgcagcaataggcggtcccacagcacagaccctcagtgggtat
ggggtaaaggtgtctgtcattcctgaaaaattcgttttcgaggaagtactcaagtcgatc
aaggaccacctcccataa

DBGET integrated database retrieval system