KEGG   Methanolobus psychrophilus: Mpsy_2902Help
Entry
Mpsy_2902         CDS       T02280                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
mpy  Methanolobus psychrophilus
Pathway
mpy00010  Glycolysis / Gluconeogenesis
mpy01100  Metabolic pathways
mpy01110  Biosynthesis of secondary metabolites
mpy01120  Microbial metabolism in diverse environments
mpy01130  Biosynthesis of antibiotics
mpy01200  Carbon metabolism
mpy01230  Biosynthesis of amino acids
Module
mpy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mpy_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mpy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpsy_2902
Enzymes [BR:mpy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Mpsy_2902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N 2-Hacid_dh_C IlvN GFO_IDH_MocA NAD_binding_3 TrkA_N Sacchrp_dh_NADP Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: AFV25101
UniProt: K4MTY0
Position
complement(2779882..2780889)
Genome map
AA seq 335 aa AA seqDB search
MSKVKVAINGYGTIGKRVADAVNLQDDMEVIGISKTRPNFETQLAHQKGYPVYTLADKAD
AMKKAGIPVSGSIEDMVANADIVVDCTPGGVGEENKSLYEKAGVKAIWQGGEEHELAGVS
FNATANYEEAFGKDFVRVVSCNTTGLCRVIYPLDQQFGVNKVRVTLMRRAADPGDIKKGP
INAIVPNPIKLPSHHGPDVKTIMPHINIVSTAVKLPTTLMHVHTLNIELDKECSAADVRS
IFEKQPRIRLIGQGINSTAEIIELGRDLGRPRNDMWENCVWDDSITMHEGELYFFQAIHQ
ESIVIPDNVDAIRAMTELEKDGARSVAKTNKAMGI
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaagtaaaagtggctataaatggttacggtaccataggtaaaagagttgcagat
gctgtgaacctgcaggacgatatggaagtcataggtatttccaagaccagacctaacttt
gagacccagcttgcacatcagaagggctatccggtatatactcttgcagacaaggcagat
gcaatgaaaaaggcaggaatacctgtgtccggcagtattgaagacatggttgcaaatgcc
gatattgtggttgactgcactcccggaggagttggagaagagaacaagagcttatacgag
aaggctggcgtcaaggccatctggcagggcggggaagagcacgagcttgctggtgtttct
ttcaatgcgacagccaattacgaagaggccttcggtaaggacttcgtaagagtagtctcc
tgtaacaccacaggtctgtgcagggtcatctatcctctggaccagcaattcggcgtcaac
aaagtaagggtcacccttatgagaagagcagccgaccccggagatatcaagaaaggacct
atcaacgcaatagtgccaaaccccatcaaactcccttcacaccacggcccggatgtcaag
accatcatgcctcacatcaatatagtgtcgactgcagtaaaacttcctacgacgctcatg
catgtacacacactcaacatcgagctcgataaagaatgctctgcggctgatgtaaggagc
atctttgagaagcagccccgcataaggctcattgggcaaggcattaactccactgccgag
ataatagagcttggcagggacctcggacgtccgaggaacgatatgtgggagaactgtgta
tgggatgattccatcacaatgcacgaaggagaactctatttcttccaggccatccatcag
gaatccatcgttataccggataatgtggatgcaatccgtgcaatgacggaacttgagaag
gacggcgcaagatccgtagctaagaccaacaaagcaatgggtatctga

DBGET integrated database retrieval system