KEGG   Marinitoga piezophila: Marpi_0036Help
Entry
Marpi_0036        CDS       T01665                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
mpz  Marinitoga piezophila
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpz00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Marpi_0036
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Marpi_0036
Enzymes [BR:mpz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Marpi_0036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(27391..28689)
Genome map
AA seq 432 aa AA seqDB search
MKHRLEIETMGKMKVAGPQYANGEITISGSKNSALPILAATILTDEKVILHNIPNLADVN
TMIEILENTGKKVTWENSTLVIEKGEEKINSILPYGPVRKMRASFNVLGPLTIRNGYAKV
ALPGGCSIGVRPVNFHLEGLKKLGIESKIEHGYTNSKFTENNHQKKIHISLPFPSVGATE
HLITTAVMLKDTETILTNCAQEPEIVDLCNFLISMGARIEGQGSSNIKIYGTDRLYGTEY
TIIPDRIEAGTYAILGAILGGKVTLNNVIEDHLFSLLDIFEKLGIHYEFKNNTLIVSGIS
KMELTPVDVETSTFPGFPTDLQPQLMVLLSLIPGRSSITENVFKTRFNHVDELNRMGAKI
FVESNTAIITGVTKLSGAPLEATDLRASAALLIAALAAEGETVINNVDHIFRGYEKLFDK
LEKLNLSVEYFE
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatagattggagattgaaaccatgggtaaaatgaaagttgccggacctcaatat
gcaaacggtgaaatcaccatatccggttcaaaaaattcggcattacctatattagctgca
acaattctaaccgatgaaaaggttatattgcataatataccaaatcttgctgacgttaat
acaatgattgaaatattagaaaacacaggtaaaaaggttacgtgggaaaactcaacatta
gttatagaaaaaggcgaagaaaaaatcaattctattttaccctatggtcctgtaagaaaa
atgcgagcttcatttaacgtacttggcccacttaccataagaaatggttatgcaaaagtt
gcattacctggaggttgttcaataggtgtaagacctgttaattttcatttagaaggttta
aaaaaattaggaattgaatcaaaaatcgaacatggttatacaaattcaaaatttacagaa
aataatcatcagaaaaaaatacatatttcattgcctttcccaagtgttggtgcaactgaa
catttaattacaacagcagtaatgttaaaagatactgaaacaatattgaccaattgtgcc
caagaacccgaaattgtagatttatgtaatttcctaatttcaatgggagctagaatcgaa
ggtcagggatcatctaatatcaaaatttatggcaccgatagattatacggaacagaatat
actattattccagatagaattgaagctggaacttatgctatattaggagctatactcggg
ggaaaagttactttaaacaatgtaatagaagatcatcttttctccttacttgatattttt
gaaaaactcggaattcattatgaatttaaaaataatacgttaattgttagcggtatttca
aaaatggaattaactcctgttgatgttgaaacctcgacattccctggatttccaacagat
ttacaacctcaactaatggtattgcttagcttaattcctggaagatcatctataacagaa
aatgtttttaaaacaagatttaatcatgttgatgaacttaacagaatgggtgcaaaaatt
tttgttgaaagtaatacggcaattattacaggagtaacaaagttatcaggcgctccactt
gaagcaacagatttaagagcatcagcagcattattaattgctgcgttagcagctgaaggg
gaaactgtaattaataacgttgatcatatatttagaggatatgaaaaattatttgacaaa
ttagaaaaactaaatttaagtgttgaatactttgaataa

DBGET integrated database retrieval system