KEGG   Marinitoga piezophila: Marpi_0112Help
Entry
Marpi_0112        CDS       T01665                                 

Definition
triosephosphate isomerase
Orthology
K00927  
phosphoglycerate kinase [EC:2.7.2.3]
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mpz  Marinitoga piezophila
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mpz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Marpi_0112
   01230 Biosynthesis of amino acids
    Marpi_0112
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Marpi_0112
   00051 Fructose and mannose metabolism
    Marpi_0112
   00562 Inositol phosphate metabolism
    Marpi_0112
Enzymes [BR:mpz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     Marpi_0112
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Marpi_0112
Exosome [BR:mpz04147]
 Exosomal proteins
  Proteins found in most exosomes
   Marpi_0112
  Exosomal proteins of colorectal cancer cells
   Marpi_0112
  Exosomal proteins of bladder cancer cells
   Marpi_0112
  Exosomal proteins of melanoma cells
   Marpi_0112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
109065..111032
Genome map
AA seq 655 aa AA seqDB search
MDKMTIKDIELKGKKVIMRVDFNVPMKDGVITNDKRIKAALPTIKHALNEGAKVILLSHL
GRPKGEPKPEFSLKPVAERLAELLGQEVKFVPEVVGDEVKKAVDELKEGEVLVLENTRYM
KGETKNDPELAKQWAELADIHVNDAFGTAHRAHASNVGIAQYIPSVAGFLMEKEIKFLSK
ATANPEKPYVVILGGAKVSDKIGVITNLLEVADKILIGGAMMFTFLKALGKEIGSSKFEE
DKVDLAKELLEKANEKGVELVLPVDAVIAQKLEAGVEKKVVKIEDGIEDGWMGLDIGPES
IELFKSKLAGAKTVVWNGPMGVFEIDDFATGTKEVANMVAEITDEGAITIIGGGDSAAAI
EKFGLERKVSHVSTGGGASLEFLEGKELPGIASIASKKKINKRKYILAGNWKMNKTNLEA
AEFISKLTAKIGKEKKFEVVIAPTFLALEKAVDLTASTNINVAAQNMHFEDKGAFTGEVS
ADMLKSLGVNYVILGHSERRNIFGETDEIINKKIKKALEKDLTPIFCIGEKLEEREKDLT
FNVIEKQVKEGLYGIEKEDVKKIVIAYEPVWAIGTGKVATPEQAEEVHAYIRKLLSEMFD
EDVAESVTILYGGSVKPENYFGLFTKPNIDGGLVGGASLKESFIDLADIMRTIIV
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atggataaaatgacaattaaagatattgaattaaaaggtaaaaaggttattatgagagtt
gattttaacgttccaatgaaagatggagtaattacaaacgataaaagaataaaagctgca
ttgccaacaataaaacatgctttaaatgaaggcgcaaaagtgatattattatcacattta
ggaagaccaaagggagaaccaaaaccagaattctcattaaaaccagtagcagaaagattg
gcagaattattagggcaggaagtaaaatttgttccagaagtagtaggagacgaagttaaa
aaagctgttgatgaattaaaagaaggtgaagtattagttcttgaaaatacaagatatatg
aaaggcgaaacaaaaaatgatcctgaacttgcaaaacaatgggcagaattagcagatatt
catgttaatgatgcatttggaacagcacatagagcacatgcttcaaatgttggaattgca
caatatataccaagtgtagcaggattcttaatggaaaaagaaataaaattcctttcaaaa
gctacagctaatcctgaaaagccatatgtagtgatacttggcggagctaaagtttcagat
aaaataggcgttattacaaacttacttgaagttgcagataaaatattaattggtggagct
atgatgtttacattcctcaaggcattaggtaaagaaataggttcatcaaaatttgaagaa
gataaagttgacttagcaaaagaattattggaaaaagcaaatgaaaaaggtgtagaatta
gtattgccagttgatgcagttattgcacagaaattagaagctggtgttgaaaagaaagta
gtaaaaattgaagacggcattgaagatggctggatgggacttgacattggacctgaaagc
atagaattattcaagtcaaaattagctggagcaaaaactgttgtatggaatggaccaatg
ggtgtatttgaaatagatgattttgcaacaggaacaaaagaagttgcaaatatggttgct
gaaatcacagatgaaggtgcaataacaattattggtggtggagacagtgcagcagccata
gaaaaattcggtcttgaaagaaaggtttcacatgtttcaacaggtggaggagcttcattg
gaattcctcgaaggaaaagaattaccaggtatagcaagtattgcatctaaaaaaaaaata
aataaaagaaaatatattcttgctggaaactggaaaatgaataaaacaaatcttgaagca
gcagaattcatttccaaattaacagcaaaaataggtaaggaaaagaaatttgaagttgta
atagctccaacattccttgcattagaaaaggctgtggatttaacagcaagcacaaatata
aatgttgcagctcaaaatatgcactttgaagataaaggtgcatttactggagaagtatca
gctgacatgttaaagtcattaggtgtaaactatgtaattcttggacattcagaaagaaga
aatatttttggtgaaacagatgaaataataaacaaaaaaatcaagaaagctcttgaaaaa
gatttaacacctatattctgtattggcgaaaaattagaagaaagagaaaaagacttaact
tttaatgtaatagaaaaacaggttaaagaaggattatatggaatagaaaaagaagatgtc
aaaaaaatagttattgcatatgaaccagtatgggcaattggaactggaaaagtagcaaca
ccagaacaggctgaagaagttcatgcatatataagaaaattattaagcgaaatgtttgat
gaagatgttgcagaatcagtaacaatattatatggaggtagtgtaaaaccagaaaattac
tttggattatttacaaaaccaaatatcgatggtggtcttgttggaggcgcatcattaaaa
gaatcatttatagacttagcagatattatgagaacaataatagtttaa

DBGET integrated database retrieval system