KEGG   Marinitoga piezophila: Marpi_0145Help
Entry
Marpi_0145        CDS       T01665                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mpz  Marinitoga piezophila
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:mpz01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mpz01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mpz00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:mpz00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mpz00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mpz00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:mpz00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
139779..140747
Genome map
AA seq 322 aa AA seqDB search
MPQIKKIGIITSGGDAPGMNAAVRAVTRTATSNGLEVIGFYKGYAGILDKEYTELTYASV
GGIMEKGGTILRTARVPGFKDPNIRAEAARNLKELGIDALIVIGGEGSLTGAKLLYEEHG
IPIVGIPASIDNDIPDTDMAIGVDTCLNTAVDSMQKLKDTASSHERAFIVEVMGRGSGYI
ALMSGIAVGAEGIIIPELPIDYDQLTDKIWEQRKRGKINCIIVVAEGAASAYTVARHFEN
KIGYETRITILGHIQRGGSPTAFDRILASRMGYEAVKFLLNGEAGVMVALNRSKLIAVPI
DKVLSEKKELDYELVKLANTLS
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgcctcaaattaagaaaataggtattataacaagtggtggagatgctccggggatgaat
gcagcagtacgtgctgtaacaagaacagcaacttcaaatggattggaagtaataggattc
tacaaaggttatgcaggaattcttgataaggaatatactgaattgacttatgcatctgtt
ggaggaataatggaaaaaggcggaactattttaagaactgcgagggtaccgggatttaaa
gatcctaatattagagcagaagcagcaagaaatttaaaagaactgggtatagatgcatta
attgtaattggtggtgaaggaagtttaacaggtgctaaattattatatgaagaacatgga
ataccaattgttggaattcctgcttctattgataacgatatacctgatacagatatggca
attggtgttgatacatgtttaaatacagctgtagactcaatgcaaaaattaaaagataca
gcatcttctcatgaaagagcatttattgtagaagtaatgggaagaggttctggatatata
gctttaatgtctggtatagcagttggtgctgaaggaataataattccggaattgccaatt
gactatgatcaattaacagataaaatttgggaacaaagaaaaagaggaaaaataaattgt
attattgttgttgcagaaggtgctgcaagcgcatatacagttgcaagacattttgaaaat
aaaatagggtatgaaacaagaataaccattttaggtcatattcaaagaggagggtcacca
actgcatttgatagaatattagcttcaagaatgggttatgaagctgtaaagtttttgctt
aatggagaagctggagttatggttgctttaaacagaagcaaactaatagcagttcctatt
gataaagtattaagtgaaaagaaagagttagattatgaattagtaaaattagcaaataca
ttatcataa

DBGET integrated database retrieval system