KEGG   Marinitoga piezophila: Marpi_0145Help
Entry
Marpi_0145        CDS       T01665                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mpz  Marinitoga piezophila
Pathway
mpz00010  Glycolysis / Gluconeogenesis
mpz00030  Pentose phosphate pathway
mpz00051  Fructose and mannose metabolism
mpz00052  Galactose metabolism
mpz00680  Methane metabolism
mpz01100  Metabolic pathways
mpz01110  Biosynthesis of secondary metabolites
mpz01120  Microbial metabolism in diverse environments
mpz01130  Biosynthesis of antibiotics
mpz01200  Carbon metabolism
mpz01230  Biosynthesis of amino acids
mpz03018  RNA degradation
Module
mpz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mpz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Marpi_0145
   00030 Pentose phosphate pathway
    Marpi_0145
   00051 Fructose and mannose metabolism
    Marpi_0145
   00052 Galactose metabolism
    Marpi_0145
  Energy metabolism
   00680 Methane metabolism
    Marpi_0145
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Marpi_0145
Enzymes [BR:mpz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Marpi_0145
Protein phosphatases and associated proteins [BR:mpz01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Marpi_0145
Messenger RNA biogenesis [BR:mpz03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Marpi_0145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Peripla_BP_6 DAGK_cat Scytalone_dh
Motif
Other DBs
NCBI-ProteinID: AEX84601
UniProt: H2J383
Position
139779..140747
Genome map
AA seq 322 aa AA seqDB search
MPQIKKIGIITSGGDAPGMNAAVRAVTRTATSNGLEVIGFYKGYAGILDKEYTELTYASV
GGIMEKGGTILRTARVPGFKDPNIRAEAARNLKELGIDALIVIGGEGSLTGAKLLYEEHG
IPIVGIPASIDNDIPDTDMAIGVDTCLNTAVDSMQKLKDTASSHERAFIVEVMGRGSGYI
ALMSGIAVGAEGIIIPELPIDYDQLTDKIWEQRKRGKINCIIVVAEGAASAYTVARHFEN
KIGYETRITILGHIQRGGSPTAFDRILASRMGYEAVKFLLNGEAGVMVALNRSKLIAVPI
DKVLSEKKELDYELVKLANTLS
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgcctcaaattaagaaaataggtattataacaagtggtggagatgctccggggatgaat
gcagcagtacgtgctgtaacaagaacagcaacttcaaatggattggaagtaataggattc
tacaaaggttatgcaggaattcttgataaggaatatactgaattgacttatgcatctgtt
ggaggaataatggaaaaaggcggaactattttaagaactgcgagggtaccgggatttaaa
gatcctaatattagagcagaagcagcaagaaatttaaaagaactgggtatagatgcatta
attgtaattggtggtgaaggaagtttaacaggtgctaaattattatatgaagaacatgga
ataccaattgttggaattcctgcttctattgataacgatatacctgatacagatatggca
attggtgttgatacatgtttaaatacagctgtagactcaatgcaaaaattaaaagataca
gcatcttctcatgaaagagcatttattgtagaagtaatgggaagaggttctggatatata
gctttaatgtctggtatagcagttggtgctgaaggaataataattccggaattgccaatt
gactatgatcaattaacagataaaatttgggaacaaagaaaaagaggaaaaataaattgt
attattgttgttgcagaaggtgctgcaagcgcatatacagttgcaagacattttgaaaat
aaaatagggtatgaaacaagaataaccattttaggtcatattcaaagaggagggtcacca
actgcatttgatagaatattagcttcaagaatgggttatgaagctgtaaagtttttgctt
aatggagaagctggagttatggttgctttaaacagaagcaaactaatagcagttcctatt
gataaagtattaagtgaaaagaaagagttagattatgaattagtaaaattagcaaataca
ttatcataa

DBGET integrated database retrieval system