KEGG   Marinitoga piezophila: Marpi_0164Help
Entry
Marpi_0164        CDS       T01665                                 

Definition
adenine specific DNA methylase Mod
Orthology
K07316  
adenine-specific DNA-methyltransferase [EC:2.1.1.72]
Organism
mpz  Marinitoga piezophila
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
159433..161577
Genome map
AA seq 714 aa AA seqDB search
MINEENIFEQNLPDNIYILKKYFPQCFDKEGNFNLEKFKEEIKINEINLSKESYSLEWLG
KSYARVLTHEPVRTFIKEDEEFNSKEENRKSQNLLIKGDNLEVLKHLLNAYREKIKMIYI
DPPYNTGKDDFVYQDDRKFSKEELSKLAGISEEKAKRILDFVNSKSNSHSAWLTFMYPRL
YIARQFLREDGVIFVSIDDNEVAQLKILMDEIFGEENFIALLSVENNPKGRKNSNFVSIS
NDYCLIYAKNKGESYFIENLPKLKTELKVDEFGRYYTHGKRVIVGESSNKEVSVNSDKHY
TVYYNESEKKIVIKKEENINTIDVKLIQQGYKRYISTKNGKFIENTYTSSKFKELFETNS
LIFKENSIYEKDFNTFIRIKSILKNTDEIDLKTETAGTYLNNLFGIPNGKDKKIFDNPKN
PSFIKLLITLFEEKDFLILDFFSGSGTTGDAVMQLNAEDGGNRKYILVQLPEPIEEKKNK
TAYDFVKNELKVDNPTIFDITKERLIRAAKKIKEDVENELKNKKEELEKIINKKKKNKKD
EEKIIILNEEINKLEKKVNNIKNQDLGFKIFETIPNNEGKWESYKINAKEFNPKIKLFDE
NKLTNDDLKTLLTTWKLYDGIILTEDLKELDLDGYKSYYHHEKGILYLINKEFKTENLKK
LLEEIDENPNFNPLKIIAFGYHFESKVLREIAENLKNYINKKESADNIEFIVRY
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgattaacgaagaaaatatttttgaacaaaatcttccggataatatttatattttaaaa
aagtatttccctcaatgttttgataaagaaggtaattttaatttagaaaagtttaaagaa
gaaataaaaataaatgaaattaacttatcaaaagagagttacagtcttgaatggcttgga
aaaagttatgcgagagtattaactcatgagcctgttagaacttttataaaagaagatgaa
gaatttaattcgaaagaagaaaatagaaaatcacaaaatcttcttataaaaggtgataat
ttagaagtattaaaacatcttttaaatgcatatagagaaaaaataaaaatgatatatatc
gatccaccgtataatacaggaaaagatgattttgtatatcaggatgacagaaaattttca
aaggaagaattgtctaaattagcaggaatttctgaagaaaaagcaaaaagaattttggat
tttgtaaatagtaaaagtaattcacattctgcatggcttacttttatgtatccaagactt
tacatagctaggcaatttttgagagaagatggagttatttttgtgagtattgatgataat
gaagttgcacaactaaaaattttaatggatgaaatttttggggaagaaaattttattgca
ttgttatccgttgaaaacaatcctaaaggtagaaaaaattctaattttgtttcaatttca
aatgattattgtttaatttatgcaaaaaataaaggtgaaagttattttatagaaaatctt
cctaaattaaaaacagaattaaaagtggatgaatttggaagatactatactcatggaaaa
agagttattgttggtgagagttcaaataaagaagtgtcagttaattctgataaacattat
acggtttattacaatgaaagcgagaaaaaaattgttataaaaaaagaagaaaatattaat
actatagatgtaaaattgatacaacagggatataaaagatatatctcaacaaaaaatggc
aaatttatagaaaatacatatacatcttcaaaatttaaagaattatttgaaaccaattct
ttaatttttaaagagaattctatttatgagaaagattttaatacttttattagaataaaa
agtattttaaaaaatactgatgaaattgatttaaaaacagaaactgcaggaacatatctt
aataatctttttggaataccaaatggcaaagataaaaaaatttttgataatcctaaaaat
ccttctttcattaagttattaattacgctttttgaagaaaaagattttcttattttagac
ttcttttccggttctggaacgacaggcgatgcagtaatgcaactaaatgcagaagatggg
ggtaatagaaaatatattttggttcaattaccagagccgattgaggaaaagaaaaacaaa
actgcttatgattttgtaaaaaatgaacttaaggtagataatcctactatttttgatata
acaaaagaaaggttaattagagcagctaaaaaaataaaagaagatgttgaaaatgaattg
aaaaataaaaaggaagaattagaaaaaataataaacaaaaaaaagaaaaataaaaaagat
gaggaaaagataataatactcaatgaagaaataaataaattagaaaaaaaagtgaataat
ataaaaaatcaagatttaggatttaaaatatttgaaactattccaaataatgaaggaaaa
tgggaaagttataaaattaatgctaaagaatttaatccaaaaataaaattatttgatgag
aataagttaactaatgatgatttaaaaacacttcttactacatggaaactatatgacgga
ataattttaacagaagatttaaaagaacttgatcttgatggatataaaagttattaccat
catgaaaaaggaattctttatcttataaataaggaatttaaaacggaaaatttaaaaaaa
ttattagaagaaatagatgaaaatccaaactttaatcctttgaaaataatagcatttgga
tatcattttgaaagtaaagtgttgagagaaattgcagaaaatctaaaaaattatatcaat
aaaaaagaaagtgcagataatattgagtttatagtgaggtattaa

DBGET integrated database retrieval system