KEGG   Marinitoga piezophila: Marpi_0165Help
Entry
Marpi_0165        CDS       T01665                                 

Definition
restriction endonuclease
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
mpz  Marinitoga piezophila
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
161580..164453
Genome map
AA seq 957 aa AA seqDB search
MMRFHFEKNLEHQNRAVESIINVFKGVEIIEPFGIEKEYVNPIFNKDTNFSYVNNIGSIQ
EQNDIKRNVKGKSNIIDIMMETGTGKTYTYTKTIFELNKLYGIFKFIIVVPTIAIKAGTI
NFLRSESAREHFKDQYGKIIELHVVASQKSNKNKKLYMPQAVSNFVNAGRFEKDKIHVLI
INLGMINSPTMKKSYDKTLLDKYSVPFDAIASVNPFMIIDEPHKFDKSNKTWKNIREKMK
PQFILRFGATFKEYENLIYTLTAAEAFNRNLVKGVIAHITEFEDGKNVFVRFVNSNGKEA
TFELTKKGSSKKIFKLIKNESLEKIHPAMKNLIIEKLNENTIILSNGLELKKGDKINPYS
YAEKLQEIMIKEAVKNHFKLEKEYLTRNIKIKPLTLFFIDNIDEYRNKEGYIRKTLENYV
EVEVKELLKKEKNEFYRNYLKKTLEDISKTHGGYFAADKRENDEVIEKEVNEILHDKQAI
LDLENPRRFIFSKWTLREGWDNPNVFQICKLRSSGSEISKLQEVGRGLRLPVNQYGNRVK
NEQFYLHYFVDFTENDFVEKLVKEINDKSGAISREDKPEKLDDVMIKRICKIYKISEEEL
LETLDKNNVITRTNKFKENGFEYIKKNYPLIFNGVNSNKIKKDTEFKKKVKIRVEKYPLL
KELWEKLNEKVILEYKIKNEEQFKEIFLDFLKKYDPFKPEIFQEKIKKLNFENYEAMVNE
EISIYGEENSFIQTMSYEEFLKELSKKLYINIKTLHNAFVEAEIEMNKYLNQTTIRLFKQ
KFDNYLMFNALNKFSIEYQKVTGSIHPTKITNSDGMVKKEIDSSDIGIFYSEEQVSDDYL
FEELFYDSDLERENIKKEIKEIIVFTKIPKNSIKIPIAGGKTYSPDFAYVLDYENGQKKM
YFIVETKDTDKDSLRDEERIKIKHAEKFFGDTIKIKFKTQFKDDDIANLIKEIYKDI
NT seq 2874 nt NT seq  +upstreamnt  +downstreamnt
atgatgagatttcattttgaaaaaaatttagaacatcaaaatcgtgctgtagaatctatt
attaacgtttttaaaggtgttgagataatagaaccatttggaatagaaaaagaatatgtt
aatcctattttcaataaagatacaaattttagttacgtaaataatattggaagtattcaa
gaacaaaatgatattaaaagaaatgtgaaaggaaaaagtaatattatagatattatgatg
gaaacgggaactggaaaaacatatacatatacaaaaactatttttgaactcaataagtta
tatggaatttttaaatttattatagttgttccaacaatagcaattaaagctggaacaata
aattttttaagatcagaaagtgcaagagaacattttaaagatcaatatggaaaaattatt
gaattacatgttgtagcgagtcaaaaatctaataaaaataaaaaattatatatgccacaa
gctgttagtaattttgtaaatgctggaagatttgaaaaagataaaatacatgttcttatt
attaatctaggaatgataaattctccaactatgaaaaaaagttatgataaaactttatta
gataaatattcagtaccatttgatgcaattgcttcagtaaatccttttatgattattgat
gaaccacataaattcgataaatctaataaaacttggaagaatattcgagaaaaaatgaag
ccacaattcattttaagatttggagcaacttttaaggaatatgaaaatttaatatataca
cttacagcagcagaagcatttaatagaaatttggtaaaaggggttattgctcatattaca
gaatttgaagatgggaaaaatgtatttgttagatttgtaaattcaaatggaaaagaagcg
acatttgaattaaccaaaaaaggtagttcaaaaaaaatttttaaattaataaaaaatgaa
agtcttgaaaaaatacatcctgcaatgaagaatttaattattgaaaaattaaatgaaaat
actattattttatctaatggtttagaacttaaaaaaggagataaaataaatccttattcc
tatgctgaaaaattgcaagaaataatgatcaaagaagctgttaaaaatcatttcaaatta
gaaaaagaatatcttacaagaaatataaaaataaagccgttaactttattttttatagat
aatattgatgaatatagaaataaagaaggttatattagaaaaacacttgaaaattatgtt
gaagtagaagtaaaagaattattaaagaaagaaaaaaatgaattttatagaaattatcta
aaaaaaactttagaagatatttcaaaaacccatggtggatatttcgctgcagataaaagg
gaaaatgatgaagttatcgaaaaagaagtaaatgaaatattacatgataaacaagcaata
ttagatttggaaaatccaagaagatttatattttcaaaatggactttaagggaaggttgg
gataaccctaatgtttttcaaatatgtaaattaagaagtagtggttcagaaatttccaaa
ttacaagaagttggaagaggattaagattgcctgtgaatcaatatggtaacagagttaaa
aatgaacaattctatttacattattttgtagattttactgaaaatgattttgtggaaaag
ttagttaaagaaataaatgataaatcaggagctatttcgagagaggataaacctgaaaaa
cttgatgatgtaatgattaaaagaatctgtaaaatttataaaattagtgaagaagagtta
ttagaaactttagataaaaataatgttataacaagaactaataaatttaaagagaatgga
tttgaatatattaaaaaaaattatcctcttatatttaatggagttaattctaataaaata
aaaaaagatactgaattcaagaaaaaagtaaaaataagagttgaaaaatatccattatta
aaggagctttgggaaaagcttaatgaaaaggttatacttgaatataaaataaaaaatgaa
gaacaattcaaggaaatatttttggattttttaaaaaaatatgacccttttaaaccagaa
atttttcaagaaaaaattaaaaaattaaattttgaaaattatgaagcaatggtaaatgaa
gaaatttcaatttatggtgaagaaaatagttttattcaaacaatgagttatgaggaattt
ctgaaagaattatctaaaaaattatatataaatataaaaactttgcataatgcttttgta
gaagccgaaatagaaatgaataaatatcttaatcaaactacaattagattattcaaacaa
aaatttgataattatttaatgtttaatgcattaaataaatttagtatagaatatcagaag
gttactggttcaattcatccaactaaaattactaattctgatgggatggttaaaaaagaa
attgattcctctgatattggaattttctattcggaagaacaagtttctgatgattattta
tttgaagaattattttatgattcagatttggaaagagaaaatataaaaaaagaaataaaa
gaaataattgtttttacaaaaattcctaaaaactccataaaaataccgatagctggtgga
aaaacatattccccggattttgcatatgttttagattatgaaaatggccaaaagaagatg
tattttattgtagaaacaaaggatactgataaagatagtttaagagatgaagaaagaata
aaaataaaacatgcagagaaattttttggagatactataaaaattaaatttaaaactcaa
tttaaagatgacgacatagcaaatttaataaaagaaatttataaagatatttaa

DBGET integrated database retrieval system