KEGG   Marinitoga piezophila: Marpi_0289Help
Entry
Marpi_0289        CDS       T01665                                 

Definition
pyridoxal-phosphate dependent TrpB-like protein
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mpz  Marinitoga piezophila
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mpz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Marpi_0289
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Marpi_0289
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Marpi_0289
Enzymes [BR:mpz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Marpi_0289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(299457..300731)
Genome map
AA seq 424 aa AA seqDB search
MGKRERVYLSVEEMPKYWYNALADLPFELDPPLNPQTKEIMKPEELEAIFPKPIVEQEVT
KERYIKIPDAVLEEYAIFRPTPLIRATNLEEYLETPARIYYKYEGVSPTGSHKTNTSIPQ
AYYNKISGVDTLVTETGAGQWGSALSYAGLKFGLNIEVYMVKTSFEQKPMRKHLINLFNG
KVTPSPSLDTEFGKKMISMDEDNPGSLGIAISEALEVVFTKKNAKYALGSVLNHVLLHQS
IIGLEIKKQLEKINESADVVIGCHGGGSNLGGTILPFVPEKLSNDNIKFLACEPKSCPSL
TEGEYRYDNGDTAGLTPLMKMYTLGKEFIPPKIHAGGLRYHGSAPIIARLKHEGLLDAVA
FSQDETFEAAKLFAKLEGIVPAPESSHAIAGAIKEAIEAKENKEEKVIVFTLSGHGLLDL
TAYS
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaagagaaagagtttatttgtctgttgaggagatgccaaaatactggtataat
gcattagctgatttgccatttgaacttgatccacctttaaatccacaaactaaggaaata
atgaaaccagaagaattagaggcaatttttccaaaaccaattgtagagcaggaagttaca
aaggagagatatataaagattcctgatgcagttttagaggaatatgcaattttcaggcca
acaccacttattagagcaactaatcttgaagaataccttgaaacacctgcaaggatttat
tataaatatgaaggtgtttctccaaccggcagtcataagactaatacttctattcctcag
gcatattataataaaatttctggtgttgatactcttgtcactgaaacaggtgctggacaa
tggggaagcgctttatcttatgcaggtctaaaatttggattgaacatagaggtatatatg
gttaagacaagttttgaacaaaagccaatgaggaaacatcttattaatctttttaatggt
aaggttactccaagtccaagtttagatactgaatttggtaaaaagatgatttcaatggat
gaagataatccaggtagtttaggaatagcaattagtgaagcattggaagttgtatttacc
aaaaagaatgcaaaatatgctctcggcagtgttttaaatcatgttttattgcatcagagt
ataataggacttgaaattaagaaacagcttgaaaagattaatgaaagtgctgatgttgtt
ataggatgtcacggtggaggttccaatcttggtggaacaattttgccgtttgttccagaa
aaactttctaatgataatattaaatttcttgcatgtgagccgaagtcctgtccttcttta
actgaaggtgagtatagatacgataatggcgatactgcaggtttaactcctttaatgaaa
atgtatacactgggaaaagaatttattcctcctaagattcatgcaggtggattacgttat
cacggttctgcaccaattattgcaaggttaaaacatgaagggcttttagatgctgtagct
ttttcacaggatgaaacttttgaagctgcaaaattgtttgcgaaattagaaggtattgtt
ccagctcctgaatcttcccatgcaattgctggtgcaattaaggaagcaattgaagcaaaa
gaaaataaagaagagaaggttattgtatttacattgtccggtcatgggcttcttgattta
acagcgtattcttaa

DBGET integrated database retrieval system