KEGG   Marinitoga piezophila: Marpi_0289Help
Entry
Marpi_0289        CDS       T01665                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mpz  Marinitoga piezophila
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mpz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Marpi_0289
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Marpi_0289
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Marpi_0289
Enzymes [BR:mpz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Marpi_0289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(299457..300731)
Genome map
AA seq 424 aa AA seqDB search
MGKRERVYLSVEEMPKYWYNALADLPFELDPPLNPQTKEIMKPEELEAIFPKPIVEQEVT
KERYIKIPDAVLEEYAIFRPTPLIRATNLEEYLETPARIYYKYEGVSPTGSHKTNTSIPQ
AYYNKISGVDTLVTETGAGQWGSALSYAGLKFGLNIEVYMVKTSFEQKPMRKHLINLFNG
KVTPSPSLDTEFGKKMISMDEDNPGSLGIAISEALEVVFTKKNAKYALGSVLNHVLLHQS
IIGLEIKKQLEKINESADVVIGCHGGGSNLGGTILPFVPEKLSNDNIKFLACEPKSCPSL
TEGEYRYDNGDTAGLTPLMKMYTLGKEFIPPKIHAGGLRYHGSAPIIARLKHEGLLDAVA
FSQDETFEAAKLFAKLEGIVPAPESSHAIAGAIKEAIEAKENKEEKVIVFTLSGHGLLDL
TAYS
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaagagaaagagtttatttgtctgttgaggagatgccaaaatactggtataat
gcattagctgatttgccatttgaacttgatccacctttaaatccacaaactaaggaaata
atgaaaccagaagaattagaggcaatttttccaaaaccaattgtagagcaggaagttaca
aaggagagatatataaagattcctgatgcagttttagaggaatatgcaattttcaggcca
acaccacttattagagcaactaatcttgaagaataccttgaaacacctgcaaggatttat
tataaatatgaaggtgtttctccaaccggcagtcataagactaatacttctattcctcag
gcatattataataaaatttctggtgttgatactcttgtcactgaaacaggtgctggacaa
tggggaagcgctttatcttatgcaggtctaaaatttggattgaacatagaggtatatatg
gttaagacaagttttgaacaaaagccaatgaggaaacatcttattaatctttttaatggt
aaggttactccaagtccaagtttagatactgaatttggtaaaaagatgatttcaatggat
gaagataatccaggtagtttaggaatagcaattagtgaagcattggaagttgtatttacc
aaaaagaatgcaaaatatgctctcggcagtgttttaaatcatgttttattgcatcagagt
ataataggacttgaaattaagaaacagcttgaaaagattaatgaaagtgctgatgttgtt
ataggatgtcacggtggaggttccaatcttggtggaacaattttgccgtttgttccagaa
aaactttctaatgataatattaaatttcttgcatgtgagccgaagtcctgtccttcttta
actgaaggtgagtatagatacgataatggcgatactgcaggtttaactcctttaatgaaa
atgtatacactgggaaaagaatttattcctcctaagattcatgcaggtggattacgttat
cacggttctgcaccaattattgcaaggttaaaacatgaagggcttttagatgctgtagct
ttttcacaggatgaaacttttgaagctgcaaaattgtttgcgaaattagaaggtattgtt
ccagctcctgaatcttcccatgcaattgctggtgcaattaaggaagcaattgaagcaaaa
gaaaataaagaagagaaggttattgtatttacattgtccggtcatgggcttcttgattta
acagcgtattcttaa

DBGET integrated database retrieval system