KEGG   Marinitoga piezophila: Marpi_0368Help
Entry
Marpi_0368        CDS       T01665                                 

Definition
hexose kinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
mpz  Marinitoga piezophila
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mpz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Marpi_0368
   01230 Biosynthesis of amino acids
    Marpi_0368
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Marpi_0368
   00030 Pentose phosphate pathway
    Marpi_0368
   00051 Fructose and mannose metabolism
    Marpi_0368
   00052 Galactose metabolism
    Marpi_0368
  Energy metabolism
   00680 Methane metabolism
    Marpi_0368
Enzymes [BR:mpz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Marpi_0368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
363927..364850
Genome map
AA seq 307 aa AA seqDB search
MIFTLTMNPSLDRYIYIDKLIPDDTIRAKKIKDYPAGKGIDVSRVIKELGGVSVAVALLG
GDNGRKIEEMLDQEGVIYSSVRISHETRMNIILEEETQYRMSMPGEHVKREKLQKVFDIL
QLLVREGDTVAISGSLPKGVDPDYYTGLIFSLKQWGAEVFFDADGKNLIAGLDAEPDCIK
PNTHELSRLLGKDVPEDDKYEIAREARYVLEKYHLDEILVSMGKYGSVYANWDMAMYAYP
VDLEVKSAVGAGDSFLAGYILKKNEGIEEGFRWANAAGNAAVLTPGTELCKKEDVLKLLP
QIKIEML
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgatttttacattaacaatgaatccaagtttagacaggtatatttatattgacaagctt
atacccgatgacacaataagagcaaaaaaaataaaagattatccagcaggaaaggggata
gacgtttcaagagtaataaaagaattaggcggtgtttcagtagctgttgcattattaggt
ggggataacggtcgaaaaatagaagaaatgcttgaccaggaaggtgtaatatattcttca
gttagaatatcccatgaaacacgtatgaatataatccttgaagaagaaactcaatacaga
atgagtatgcctggagaacatgttaaaagagaaaaacttcaaaaagtttttgacatctta
caattgctggtaagagaaggagatactgttgctatatcaggaagtttaccaaaaggtgtt
gatcctgattattatactggtcttatcttttcattaaaacaatggggagcagaagttttc
tttgatgctgatggaaaaaatttaattgctggtcttgatgctgaaccagattgtattaag
ccgaatactcatgaattatcccgtttattgggaaaagatgtccctgaagatgataaatat
gaaattgccagagaagcacgatatgttcttgaaaaatatcatttagatgaaatacttgta
tcaatgggaaaatatggaagtgtttatgctaattgggatatggctatgtatgcttatcct
gttgatttagaagtaaaaagtgcagttggagccggtgattcattcttagctggatatata
ttgaaaaaaaacgaaggaattgaagaaggatttagatgggcaaatgctgcaggaaatgct
gctgtattaactccaggaacagaattatgcaaaaaagaagatgtcttaaagctacttcca
caaataaaaattgaaatgttataa

DBGET integrated database retrieval system