KEGG   Marinitoga piezophila: Marpi_0472Help
Entry
Marpi_0472        CDS       T01665                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mpz  Marinitoga piezophila
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpz00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Marpi_0472
Enzymes [BR:mpz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Marpi_0472
Exosome [BR:mpz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Marpi_0472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(472740..474212)
Genome map
AA seq 490 aa AA seqDB search
MAYYLAIDEGTSSTRTLLFDEKFNLIDFSQKEINMYYPKPGWVEQDAEELYQKTEETMLE
VLEKNNISWNEIIGIGITNQRETVVAWDKNTGKALTRAIVWQCRRTDELINRYSASFWNE
VKRKTGLVKDPYFSGSKIVWMIENVPAVKEAYENGNLKVGTIESWLAFKLSGKHISDLSN
ASRTQLLNIHTLDWDDEILNTFGIKKDILPQLVNTAIEGGIETKFGPKIYGMIGDQQSAL
FGQRAFEIGDSKCTYGTGAFVLMNSGNTPPKPHPGLLTSIGWKIKDETIYSLEGSIFTVG
AFFKWLKDIEIIDDYPDLEKYSLDNDNGGVYIVPALSGLGTPYWDADARGLIIGLTRGTK
KENIIRAALESVAFSVRDVIDSMQEAVWTKIKKMNVDGGATKNKLLMKIQSDLLNAEIFV
PEFQEITALGAAFMAAIGSENLSINEIKNLQFSGIKIMPEENEKLERDYYIWKEAVLRSK
GWIKSTNINF
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggcttactatcttgcaattgatgagggaacaagcagtacaagaacgttattgtttgat
gaaaaatttaaccttatagacttttctcaaaaagaaataaatatgtattatccaaaacct
ggatgggtagagcaggatgctgaagaattgtatcaaaaaactgaagaaacaatgttagaa
gttttagaaaagaacaatatatcctggaatgaaataattgggattggaattacaaatcaa
agggaaactgttgtagcctgggataaaaacacaggaaaagctttaactcgagcaatagta
tggcaatgtaggaggacagatgaattaattaatagatattctgcatcattctggaatgaa
gtaaagaggaaaacaggattggtaaaggatccatatttttcaggttcaaaaatagtgtgg
atgatagaaaatgttccagcagttaaagaagcatatgaaaatggaaatttaaaagtggga
acaatagaatcctggttggcatttaaactttctggaaaacatattagtgatctttcaaat
gcttccagaacgcaattgttaaatatacatacattagattgggatgatgaaatattaaac
acatttggtattaaaaaagatattctgcctcagttggttaatacagctattgaaggtgga
attgaaacgaaatttggcccaaaaatttatggaatgattggtgaccagcaatctgcatta
tttggacaaagagcatttgaaattggtgattcaaaatgtacttatggaacaggtgctttt
gtattaatgaattcaggtaataccccacccaaaccacatccaggattattaacttcaatt
ggttggaaaattaaagatgaaactatttattctcttgaaggaagtatatttaccgttggt
gcattctttaaatggttaaaagatatagagattatagatgattatcctgatcttgaaaaa
tattctcttgataatgacaacggaggagtttatattgttccagcattaagtggtcttgga
acaccatattgggatgcagatgcaagaggtttaataatagggttaaccagaggtactaaa
aaagaaaatataatcagggctgctttggaatcagtagcttttagtgttagagatgttata
gactcaatgcaggaagcagtatggacaaagattaaaaaaatgaatgttgatggtggagct
acaaaaaataaattattgatgaaaatacaaagtgatttgttaaatgcagagatatttgtt
ccagaatttcaggagataacagcattaggtgcagcatttatggcagcaattggttcagaa
aatctttctattaatgaaataaaaaatttgcaattttcaggtataaagataatgccagaa
gagaatgaaaaattagaaagggattattatatctggaaggaggcagtattaagatcaaaa
ggctggataaaatcaacgaacataaacttttag

DBGET integrated database retrieval system