KEGG   Marinitoga piezophila: Marpi_0547Help
Entry
Marpi_0547        CDS       T01665                                 

Definition
nicotinamidase-like amidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
mpz  Marinitoga piezophila
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:mpz00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(548402..548989)
Genome map
AA seq 195 aa AA seqDB search
MYVEKMKDLNYDIKDTAILCVDCQNGFTLRCPEELPVEGTDEKWIEKVNEFIAEAKDIGY
TIIASKDDHPENHKSFNEWPPHCIKGTYGNELFIKHYDFLVKKGTTENTDSYSAFYEDME
TKNETELDKFLRENNFKKLIIFGLAGDVCVLATIKTAIKKGYDVAVIEDFIKSVNGKSMK
EILDLEKLKVNIEII
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtatgttgaaaaaatgaaagatttaaactatgatattaaagatactgcaattttatgt
gttgattgccaaaatggttttactcttagatgtccagaagaattgcctgtagaaggtacg
gatgaaaaatggatagaaaaggttaatgaatttatagcggaagcaaaagatattggttat
accattattgcaagtaaagatgatcatcctgaaaatcacaaatcatttaatgaatggcca
cctcattgtataaaaggaacatatggaaatgaattatttataaaacattatgatttcctc
gtaaaaaaaggaacaacagaaaatacagatagttattcagcattttacgaggatatggaa
acaaaaaatgaaacagaactggataaatttcttagagaaaataactttaaaaaacttatt
atttttggacttgctggtgatgtatgtgtccttgcaacaattaaaactgcaattaaaaaa
ggatatgatgttgctgtaattgaagatttcataaaaagtgtaaatggaaaaagtatgaaa
gaaattttggacttagaaaaattaaaggttaatattgaaattatttaa

DBGET integrated database retrieval system