KEGG   Marinitoga piezophila: Marpi_0646Help
Entry
Marpi_0646        CDS       T01665                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
mpz  Marinitoga piezophila
Pathway
mpz00010  Glycolysis / Gluconeogenesis
mpz00030  Pentose phosphate pathway
mpz00051  Fructose and mannose metabolism
mpz00052  Galactose metabolism
mpz00680  Methane metabolism
mpz01100  Metabolic pathways
mpz01110  Biosynthesis of secondary metabolites
mpz01120  Microbial metabolism in diverse environments
mpz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mpz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Marpi_0646
   00030 Pentose phosphate pathway
    Marpi_0646
   00051 Fructose and mannose metabolism
    Marpi_0646
   00052 Galactose metabolism
    Marpi_0646
  Energy metabolism
   00680 Methane metabolism
    Marpi_0646
Enzymes [BR:mpz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Marpi_0646
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Marpi_0646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AEX85084
UniProt: H2J623
Position
complement(649630..650841)
Genome map
AA seq 403 aa AA seqDB search
MKNAIYAQSGGVTSVINASAYGVIKAALNAEEIDNIYVAINGINGVFNEELADMGKEDPE
QIELLKFTPSSAFGSCRRKLKEESEFEEIFRIFDRYNIKYFFYNGGNDSMDTANKIHQYA
QKIGYDIKVMGVPKTVDNDLPETDHTPGFGSIAKYLSVAILEGTLDVKSMAADSTKVFIL
ETMGRHAGWVAASTALAKRHESDGPHIILLPEVPFNKEKFFEKVEKTIEKYGYCSIAASE
GIKYADGTFVAARGYKDNFGNVQLGGIGSTLANLIRSELGIKTHYAVPDYLQRSGRHISS
QVDVNEAIEVGAMAVKYALEGKSGYMVGIERLMNSPYMSTTKLIPLDNVANETKLVPPEF
ITEDGMFVNEKFIEYALPLIEGEYYPPYLNGIPLYARLKLNRI
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgctatatatgcacaatcaggaggagttaccagtgtaataaatgcatcagca
tatggtgtaataaaagctgcattaaatgcagaagaaattgataatatctatgttgcaatc
aatggaattaatggtgtgtttaatgaagagttagcagatatggggaaagaagatccagaa
caaatagaattattaaagtttactccatcaagtgcttttggttcatgtagaagaaaatta
aaagaagaaagtgaatttgaggaaatatttagaatatttgacaggtataacataaagtac
ttcttttataatggtggaaatgattcaatggatacagcaaataaaatccatcaatacgca
cagaaaataggatatgatatcaaagtaatgggagtaccaaaaacggtagataatgattta
cctgaaacagatcatacaccaggatttggttctattgcaaaatatctttctgttgctatt
ttagaaggaacattagatgtaaaaagcatggctgcagattccacaaaagtatttatttta
gaaacaatgggaaggcatgcaggatgggttgcggcttctacagcgcttgccaaaaggcat
gaaagtgacggaccacacattatattattgccagaagttccttttaataaagaaaagttt
tttgaaaaagtggaaaaaacaattgaaaaatacggctattgttcaattgcagcttcagaa
ggaataaaatatgcagatggaacattcgttgcagctcgaggatataaagataattttgga
aatgttcaattaggtggaattggttcaacgcttgctaatcttataagaagcgaattgggt
attaaaacacattatgcagtgcctgattatttacagagaagtggaagacacatttcaagt
caggtagatgtaaatgaagcaattgaagttggagcaatggccgttaaatatgcattagaa
ggcaaaagtggatatatggttggaattgaaagattaatgaattctccatatatgagcaca
acaaagttaattcctttagataatgtggcaaatgaaacaaaacttgttccaccagaattt
ataacagaagatggaatgtttgtaaatgaaaaattcattgaatatgcgttacctttaata
gaaggagaatattatccaccatatttaaatggtattccattatatgcacgattaaaatta
aataggatttaa

DBGET integrated database retrieval system