KEGG   Marinitoga piezophila: Marpi_0837Help
Entry
Marpi_0837        CDS       T01665                                 

Definition
glycosidase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
mpz  Marinitoga piezophila
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:mpz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Marpi_0837
Enzymes [BR:mpz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Marpi_0837
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
845946..847631
Genome map
AA seq 561 aa AA seqDB search
MHKNIYDKLEFLYGDEAKGVYQKLMNIIEKYKISDKDFDFSEKDVILITYGDSIKKNNEK
PLNTLHHFLNEYVKDSINTVHILPFFPYSSDDGFSVIDYKQVNPELGSWEDIQSLSKDYK
LMFDAVINHISKESKWFQEYLKGNKKYKNYFIEQEPVEELKNVTRPRALPLLHVYKTASG
EEKHIWTTFSEDQIDLNYKSTDLFLEIVEILLFYAKMGAKLIRLDAIGYLWKEIGTSCIH
LKQTHVMIQLFRDILNLTAKDVILITETNVPHHENISYFGNGYNEAQMVYNFSLPPLVLY
SFLFHDATVISKWAYTLETPSDKTTFFNFLASHDGIGLMPAKGILKDEDIDFLVEHTLRN
NGLVSYKSNPDGTKSPYELNINYFDALYDENESMELNIRKFISAYAIAAAMKGIPGIYIH
SLLGSRNYLEGVKITGMNRTINREKLNYDTLISELNDKSSLRFKIFNTFKHMLDIRKKHK
AFNPKGKQMVMFYDDSVFAFMREFKDERVLVLTNVANREITLDIDNPLSKNPYDFLNNTS
VDISDNKLHIILKPYETKWLK
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgcataagaatatatacgataaattagaatttttatatggcgatgaagcaaaaggtgta
tatcaaaaacttatgaatattattgaaaaatataaaatttctgataaggattttgatttt
tcggaaaaggacgttattttaattacttatggtgattctataaagaaaaataatgaaaag
cctttaaatactttacatcatttcttaaatgaatatgtaaaggatagtattaatactgta
catatacttccatttttcccttattcatctgatgatggcttttctgtaattgattataaa
caggttaatccagaattgggcagttgggaagatattcaatcgctctcaaaagattacaaa
ctaatgtttgatgcagttataaatcatatttccaaagaaagcaaatggtttcaggaatat
ttaaagggaaataaaaaatacaaaaattattttattgaacaggagcctgtggaggaatta
aagaatgtaactcgtccaagggcactacctttattacatgtatataaaactgcttcaggc
gaagaaaaacatatctggactacatttagtgaagatcaaattgatttaaattataaatct
acagatttgttccttgaaattgttgaaatattgcttttctacgcaaaaatgggagctaaa
ttaataagacttgatgctattggatatttatggaaagaaattggaacatcatgtatccac
ttaaaacaaacacatgtaatgattcagttgtttagagatattttaaatctcacagccaaa
gacgttattctgattacagaaacaaatgtcccgcatcatgaaaatatttcttattttgga
aatggatataatgaagctcaaatggtttataatttttcacttcctccccttgttttatat
tcttttttatttcatgatgcgactgttatatcaaaatgggcttatacattagaaacacca
tctgataagactacttttttcaattttctcgcttcacatgacggcattggattaatgcca
gcaaaaggaattttaaaagatgaagatattgattttcttgttgaacatactttaagaaat
aacggacttgtttcttataaaagcaatcctgatgggacaaaatcaccgtatgagttgaat
attaattattttgatgctttgtacgatgaaaacgaatcaatggaattgaatataagaaaa
tttatttccgcttatgcaattgctgctgcaatgaaaggtattccaggtatttatattcac
agtttattgggatcacgaaattatcttgaaggtgttaaaatcaccggaatgaacagaact
attaatagagaaaaattgaattatgataccttaatttcagaattaaacgataaaagttct
ttaaggtttaagatatttaataccttcaaacatatgctggatattaggaagaaacacaaa
gcatttaatccaaaaggaaaacaaatggttatgttttatgatgattctgtttttgcattt
atgcgagaatttaaagatgaaagagttcttgttttaaccaatgttgctaatagagaaatt
actcttgatattgataatccgctttctaaaaatccttatgactttttaaataacacttct
gttgatatttccgataataaacttcatattattcttaagccatatgaaaccaaatggttg
aaataa

DBGET integrated database retrieval system