KEGG   Marinitoga piezophila: Marpi_0956Help
Entry
Marpi_0956        CDS       T01665                                 

Definition
acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mpz  Marinitoga piezophila
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mpz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Marpi_0956
  Amino acid metabolism
   00300 Lysine biosynthesis
    Marpi_0956
Enzymes [BR:mpz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Marpi_0956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
954893..956116
Genome map
AA seq 407 aa AA seqDB search
MKEKILEHVEKNKDEIIETSKRFISINSVNPRAGGPGEKEVAEWLESYLKTMKFDEIKRY
DAPDDIVEYGFRPNIVAIYKGTSPERTIWFITHMDKVPEGDLSLWDHDPFDPVIKDGKIY
GRGAEDNGSSLVATLHGLKTLMDLNIRPKNNIALVFVSDEETGSDYGIKYLVKQGIFDKN
DWYYVPDSGNPEGSFIEIAEKSILWLKIVTEGKQAHASAPTVAKNAHRAAIYFAKELDEF
LHEKYVAKDPLFNIPFSTFEPTKKEHNVDNINTIPGTDIMYFDCRILPQYDLNEILADVE
NIKKKYEEKFGVKIHIETPQMEKAPDPTPADHPSVLKLKEAIKELRNIDATVGGIGGGTC
AAILREAGLPALVWGTMDHTAHQPNEYIKIEHLIADTKIYAYLMANF
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagaaaattcttgaacatgtagaaaaaaataaagatgaaattattgaaacttca
aaacgttttatatctataaattccgtaaatccccgtgcaggtggccccggggaaaaagaa
gttgctgaatggcttgaatcatatttaaaaacaatgaaatttgatgaaataaaacgttat
gacgcaccagatgatattgtggaatatggtttcagacctaatattgtagctatttataag
ggaacttcaccagaaagaactatatggtttattacacatatggataaagtgcctgaaggg
gatctttcattgtgggatcatgatccatttgatccagtaattaaagatggaaaaatatac
ggaagaggtgcagaagataacggaagctcacttgttgcaactcttcacggtttaaaaaca
ttaatggatttaaatattagacctaaaaacaatattgctcttgtttttgtttcagatgaa
gaaacaggtagcgattatggtataaaatatcttgtcaaacagggaatttttgataaaaat
gactggtattacgtacccgattcaggtaatcctgaaggttcttttatagaaattgcagaa
aaatccatattatggttaaaaatagttacagaaggaaaacaggctcatgcttctgcacca
actgttgctaaaaacgctcatagagctgcaatatactttgcaaaagaattagatgaattt
ttacatgaaaaatatgtcgcaaaagatcctttatttaatattccgttttcaacatttgaa
cctaccaaaaaagaacataatgtggataatataaatactattccaggaacagatataatg
tattttgattgcagaattttacctcaatacgatttaaatgaaatacttgcagatgtggaa
aatataaagaaaaaatacgaagaaaaattcggtgtaaagattcatattgaaacaccacaa
atggaaaaggctcctgatccaactccagcggatcatccatctgtattgaaattaaaagaa
gctattaaagaattaagaaatattgatgcaacagttggcggaatcggtggcggaacatgt
gctgccattttaagagaagcaggattacctgctcttgtatggggaaccatggatcacact
gcacatcaaccaaatgaatatataaagatagaacatctaattgcagatacaaaaatctat
gcatatttaatggcaaatttttaa

DBGET integrated database retrieval system