KEGG   Marinitoga piezophila: Marpi_1069Help
Entry
Marpi_1069        CDS       T01665                                 

Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mpz  Marinitoga piezophila
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mpz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Marpi_1069
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Marpi_1069
   00640 Propanoate metabolism
    Marpi_1069
   00660 C5-Branched dibasic acid metabolism
    Marpi_1069
Enzymes [BR:mpz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Marpi_1069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1094170..1095192
Genome map
AA seq 340 aa AA seqDB search
MKVHEFIGKGFLQDYGIKVPQSYLITSEKDIKVTFLPAVLKSQVLVGGRMKAGGVLFAHT
EEEFSEKAKYLLKKEIKGEKPYGVLAEEMIPIKKEYYISLLLNREEKEISILFSESGGID
IEENKDSIIKTNFEKFHEVIPEKIQKILPNLRKLFREKDLTLLEINPLIESEGGEIIALD
AVMHLDDNAIFRQTWAEEFVDEKYPFHFVKLEGDIGIIGCGAGIVMATMDAVKLHGGEPA
DFLDLGGGAEKDITLEALNLLKNSGIKKVILNIFGGITKCDEIARGLVEFNKENPDIQLF
IRLTGTNENEAKEILKKHNLNYYEDMYSMILDAVKVGEYK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagtacatgaatttattggtaagggttttttgcaagattatggaataaaagtgcct
caatcgtatctaattacttctgaaaaagacattaaagtaacattcctgcctgcagtatta
aagtctcaggtgttagtgggcggaagaatgaaagcaggcggtgtattatttgcacataca
gaagaagaattttctgaaaaagcaaaatatctgctaaaaaaagaaataaaaggcgaaaaa
ccttatggggttctcgctgaagaaatgattcccataaaaaaagaatactatatatctcta
ctacttaatagagaagaaaaagaaataagtatactattttccgaaagtggtggtattgat
atagaagaaaacaaagattcaattataaaaacaaattttgaaaaatttcatgaagtaatt
ccggaaaaaatccagaaaatattgcctaatttaagaaaattatttagagaaaaggattta
acccttcttgaaataaatccattaatcgaatcagaaggaggagaaataatcgctcttgat
gctgtaatgcatcttgatgataacgctatattcagacaaacctgggcagaggaatttgtt
gatgaaaagtatccttttcactttgtaaaacttgaaggagatattggaattatcggctgt
ggcgcaggaatagttatggctacaatggatgctgttaaattacatggtggagaaccagca
gattttcttgatcttggtggaggagctgaaaaggatattactcttgaagctttaaattta
ttaaagaattctggaataaaaaaagtaattctaaatatttttggtggaattacaaaatgc
gatgaaatagccagaggactcgttgaatttaataaggaaaatcctgatatacaattattt
ataagattaacgggaacaaatgaaaacgaagcaaaggaaattctaaaaaaacacaattta
aattattatgaagatatgtattccatgattcttgatgcagtgaaagtgggtgagtataaa
tga

DBGET integrated database retrieval system