KEGG   Marinitoga piezophila: Marpi_1069Help
Entry
Marpi_1069        CDS       T01665                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mpz  Marinitoga piezophila
Pathway
mpz00020  Citrate cycle (TCA cycle)
mpz00640  Propanoate metabolism
mpz00660  C5-Branched dibasic acid metabolism
mpz01100  Metabolic pathways
mpz01110  Biosynthesis of secondary metabolites
mpz01120  Microbial metabolism in diverse environments
mpz01130  Biosynthesis of antibiotics
mpz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mpz00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Marpi_1069
   00640 Propanoate metabolism
    Marpi_1069
   00660 C5-Branched dibasic acid metabolism
    Marpi_1069
Enzymes [BR:mpz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Marpi_1069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 UBA_4 ToxN_toxin GARS_A JmjN
Motif
Other DBs
NCBI-ProteinID: AEX85481
UniProt: H2J7Z0
Position
1094170..1095192
Genome map
AA seq 340 aa AA seqDB search
MKVHEFIGKGFLQDYGIKVPQSYLITSEKDIKVTFLPAVLKSQVLVGGRMKAGGVLFAHT
EEEFSEKAKYLLKKEIKGEKPYGVLAEEMIPIKKEYYISLLLNREEKEISILFSESGGID
IEENKDSIIKTNFEKFHEVIPEKIQKILPNLRKLFREKDLTLLEINPLIESEGGEIIALD
AVMHLDDNAIFRQTWAEEFVDEKYPFHFVKLEGDIGIIGCGAGIVMATMDAVKLHGGEPA
DFLDLGGGAEKDITLEALNLLKNSGIKKVILNIFGGITKCDEIARGLVEFNKENPDIQLF
IRLTGTNENEAKEILKKHNLNYYEDMYSMILDAVKVGEYK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagtacatgaatttattggtaagggttttttgcaagattatggaataaaagtgcct
caatcgtatctaattacttctgaaaaagacattaaagtaacattcctgcctgcagtatta
aagtctcaggtgttagtgggcggaagaatgaaagcaggcggtgtattatttgcacataca
gaagaagaattttctgaaaaagcaaaatatctgctaaaaaaagaaataaaaggcgaaaaa
ccttatggggttctcgctgaagaaatgattcccataaaaaaagaatactatatatctcta
ctacttaatagagaagaaaaagaaataagtatactattttccgaaagtggtggtattgat
atagaagaaaacaaagattcaattataaaaacaaattttgaaaaatttcatgaagtaatt
ccggaaaaaatccagaaaatattgcctaatttaagaaaattatttagagaaaaggattta
acccttcttgaaataaatccattaatcgaatcagaaggaggagaaataatcgctcttgat
gctgtaatgcatcttgatgataacgctatattcagacaaacctgggcagaggaatttgtt
gatgaaaagtatccttttcactttgtaaaacttgaaggagatattggaattatcggctgt
ggcgcaggaatagttatggctacaatggatgctgttaaattacatggtggagaaccagca
gattttcttgatcttggtggaggagctgaaaaggatattactcttgaagctttaaattta
ttaaagaattctggaataaaaaaagtaattctaaatatttttggtggaattacaaaatgc
gatgaaatagccagaggactcgttgaatttaataaggaaaatcctgatatacaattattt
ataagattaacgggaacaaatgaaaacgaagcaaaggaaattctaaaaaaacacaattta
aattattatgaagatatgtattccatgattcttgatgcagtgaaagtgggtgagtataaa
tga

DBGET integrated database retrieval system