KEGG   Marinitoga piezophila: Marpi_1143Help
Entry
Marpi_1143        CDS       T01665                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mpz  Marinitoga piezophila
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mpz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Marpi_1143
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Marpi_1143
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Marpi_1143
Enzymes [BR:mpz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Marpi_1143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1170703..1171935
Genome map
AA seq 410 aa AA seqDB search
MNKYKLRCISCGKVYEPDEVEYTCPVCGDRLGTLEVIYDYDEIKVKKEDFGKFDNIWQFE
KILPISDKAYKTPLHVGGTPYYEHKKLAEELGIKNLFIKYDGTNPTASYKDRASALAIAK
AYEKGYETIYCASTGNAASSLAGLSAPTKLKTYIFLPASAPIAKISQLFIYGANVIPIDG
TYDEAFDISLKIGEENGWYCRNSAINPYLLEGKKTGALEIAVQSNWDVPDYVLVSVGDGT
VISSFYKGFYDFYKLGLIDKIPRIIGVQAEGAAAIKRVFDKGEPFMPDDIETHTIADSIS
VGKPRDVVKACKYVKASGGYFVSVSDEEILNAIYELSIKTGIFAEPAGATSYAGLKRISE
KIGKDSTVAIVVTGNGLKDVKAIESFVNLKKVKPDLNAVREVIKEYENKI
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagtataaacttcgttgtataagttgtggaaaagtatatgaacctgatgaagtt
gaatatacatgtccagtttgcggagataggttaggaacacttgaagtaatatatgattat
gatgaaataaaggttaaaaaggaagactttggaaaattcgataatatatggcagtttgag
aaaattttaccaataagcgacaaagcttacaaaacgcctttgcatgttggcggaacaccg
tattacgaacataaaaaactcgctgaagaattaggaattaaaaatctttttataaaatac
gacggaacaaatccaactgcatcttacaaagatagagcatcagccctggctatagccaag
gcatatgaaaaaggatatgaaacaatatattgtgcttcaacaggcaatgcagccagttct
ttagcaggattatcagcaccaacaaaattaaaaacatatatatttttacccgcttcagca
ccaattgcaaaaatatcacaacttttcatatacggtgcaaacgttatcccaatagacggt
acatatgatgaagcatttgatatttcactaaaaattggtgaagaaaatggatggtattgc
agaaactcggcaattaatccatatttacttgaaggcaaaaaaaccggagctcttgaaata
gctgttcaaagcaattgggatgttccagattacgtacttgtaagcgttggcgatggtaca
gttatcagttcattctacaaaggattttacgatttctataaacttggattaatagataaa
atcccaagaattattggtgttcaggctgaaggtgccgctgcaataaaaagagtatttgat
aaaggtgaaccatttatgcctgacgacatagaaacacatacaattgcagatagcataagc
gttggaaaaccgcgcgatgtagtaaaagcctgcaaatacgtaaaagcaagtggcggatat
ttcgtaagtgtaagtgatgaagaaatattaaatgctatatatgaattatcaataaagacc
ggtatatttgccgaacccgccggagctacttcatacgctggtctgaaaaggatttcagaa
aaaattggaaaagattcaactgttgcaattgtagtaacaggaaatggattaaaagatgta
aaagcaatagaaagctttgtaaatctaaaaaaagtaaaaccagacttaaatgctgttaga
gaggtgattaaggaatatgaaaataaaatttaa

DBGET integrated database retrieval system