KEGG   Marinitoga piezophila: Marpi_1251Help
Entry
Marpi_1251        CDS       T01665                                 

Definition
(GenBank) hypothetical protein
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mpz  Marinitoga piezophila
Pathway
mpz00250  Alanine, aspartate and glutamate metabolism
mpz01100  Metabolic pathways
mpz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpz00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Marpi_1251
Enzymes [BR:mpz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Marpi_1251
Peptidases [BR:mpz01002]
 Cysteine Peptidases
  Family C44
   Marpi_1251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_7 GATase_6 Asn_synthase TPR_18 DUF3700 dCMP_cyt_deam_2
Motif
Other DBs
NCBI-ProteinID: AEX85655
UniProt: H2J2W4
Position
1289576..1291321
Genome map
AA seq 581 aa AA seqDB search
MPGFFGLISNNRIIDKINITQRRNDFLKEIYKNENLYIERQTINKFLRDKPFYKGEDYVF
LIEGVILNKVELINKYNLENFEKTIIEMYKRLGETFFNDFRGSFSGFFYDKKNNRYLIFT
NHFGDKQIFYYTHENEFIIGSEINYIVDYLRQKNYSYNPDIESAYMLLTYGFMIEDHTLI
NEIKKLIAGHYIKIENGNFEIKQYYKLDNTPDKTLSENEIIENIDSLFKTAIRYEFEKDK
EYNYNHIASLSGGLDSRMTVWIGTKMGYNMLNYTFSESDYLDETISKEIARDLKNEFLFK
SLDNGLYLIKDNIIRKQIEINSGNVLYAGNAHAKSFADIFNFSNFGVVHTGQLGDVIIGS
YMKKAVYNKEFNIVTGAYSEKLSEKIKNIKLKFDYPNEEIFKLYNRGFNGILLGNLPFQE
YTEVISPFLYKEFIDYCLKIPLDLRVNHKIYFKWILKKHPQAAKYKWEAIGAKINIPQIK
VLGRQIAITQIPHKIIRKILNKKTIMTRHHMNPLEYWYKNNHMLKSFFEKTFNEKIKNFD
ISKELKTDVQNMFESGKVIEKTQVLTLLEAYDYFWGEYQNE
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgcctggtttttttggtttaatatcaaataatagaattatagataaaattaatataacg
caaagaagaaatgattttctcaaagaaatatataaaaatgaaaatttatatattgagaga
caaactataaataagtttttaagagataaacctttttataaaggtgaagattatgttttt
ttgattgaaggagtaattttaaataaggttgagttaattaataaatataacttagagaat
tttgaaaaaactattatagaaatgtataaaaggttaggagaaactttttttaatgatttt
cgcggtagtttctccggatttttttatgataaaaagaataatagatatctaatttttaca
aatcattttggagataaacagatattttattatacacatgaaaatgaatttattataggt
tctgagattaattatattgttgattatttaagacaaaaaaactattcctataatcccgac
attgagtctgcatatatgcttttaacttatggctttatgatagaggatcatactcttatt
aatgaaataaaaaaattaattgccggacattatattaaaattgagaatggaaattttgaa
ataaaacagtattataaattggataatactcctgataaaactttatcagaaaatgagata
atagaaaatatagactctttattcaaaactgcaataagatatgaatttgaaaaggataaa
gaatataattataatcacattgcaagtttaagcggtggtctggattcacgaatgacagtc
tggattggaacaaaaatgggatataatatgcttaattatactttctcggaatctgattat
ctagatgaaactatttcaaaggaaatagcaagagatttaaaaaatgagtttttgtttaaa
tctctcgataacggattatatcttataaaagataatataataagaaaacaaatcgaaatt
aattctggaaatgtgttgtatgctggaaatgctcatgctaaatcatttgctgatattttt
aatttttctaattttggtgttgttcataccgggcaattaggtgatgtaataattggaagt
tatatgaaaaaagctgtttataataaagaatttaatatagtaaccggtgcctattctgaa
aaattaagcgaaaagattaaaaatataaaattgaaatttgattatccaaatgaagaaatt
tttaaattatataatagaggttttaatggtatccttctgggaaatcttccttttcaagaa
tatactgaagtaatttctccatttttatataaagaattcattgattattgtttaaaaatc
cctcttgatttaagagttaatcataaaatttattttaaatggatactaaaaaagcatcca
caagctgcaaaatataagtgggaagctattggagcaaaaataaatatacctcaaataaag
gttttaggtagacaaatcgctattacacaaattcctcataaaattataaggaaaatctta
aataaaaaaactataatgacaagacatcatatgaatcctttggaatactggtataaaaat
aatcatatgttaaaaagtttttttgaaaaaacatttaatgaaaaaattaaaaacttcgat
atttcaaaagaattaaaaacagatgttcaaaatatgtttgaaagtggaaaagttattgag
aaaactcaggtattaactttattagaagcttatgattatttttggggagaatatcaaaat
gaataa

DBGET integrated database retrieval system