KEGG   Marinitoga piezophila: Marpi_1259Help
Entry
Marpi_1259        CDS       T01665                                 

Definition
Asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mpz  Marinitoga piezophila
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpz00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Marpi_1259
Enzymes [BR:mpz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Marpi_1259
Peptidases [BR:mpz01002]
 Cysteine Peptidases
  Family C44
   Marpi_1259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1298299..1299735
Genome map
AA seq 478 aa AA seqDB search
MKDISFRFSKSFSRLQNKIFYNYGFFDEPIVEIYDDYIIFKGNAVRSVPLFFIVLPDKII
LTDRINKNYKVSLNNDFLDELRHFKYTLGNDTIWNNVFQLLPGQVLKVWKSGEYELFTDY
VFRNENKVKKTPKELIEILYKIFESFFNRIESDKKILIPLSGGFDSRIIAFMIKEFGFEN
RAFAFCYGQKNAEEVNVSKNVAKRLGLDWYFIEYNEQFINDIIFSDLFNKYIDFYKAFGV
TPHIQDLFSLVWLKDNGLLNSGDVVIPGHSGDFLAGSRLVYTKNINSLSSLKKAILGYHV
QIFRIKKDVKIHLENRIDEIHKNFDMGYSDIFEIFDWQERQSKYIANSVRNYEFFDLNWF
LPLWEKSLFDFFSSLDNSQRFHEKLYRESLNLLFTKYDIDIKTSDTGTSKSRETLKKFVS
PEMIIFAKRIEAILKNKGNKHNLYGIFDFGKIENSENRYIEIVGHITELLINSLRREE
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatattagttttaggttttctaaatctttttccagacttcaaaataaaatattt
tataattacggtttttttgatgaaccaattgttgagatatatgatgattatattattttt
aaagggaatgctgtgagaagcgttccgttattttttattgttttgccagataagattata
cttactgataggataaataaaaattataaagtttctttaaataatgattttttagatgaa
ttaaggcattttaaatatactctcggaaatgatactatctggaataatgtttttcaatta
ttgccaggtcaggtattaaaagtctggaaatcaggtgaatacgaattatttactgattat
gtttttagaaatgaaaataaggtcaaaaaaactccgaaagaattaatagagatattatat
aaaatctttgaaagtttttttaacagaattgaatctgataagaaaatactgattcctctc
agtggcggttttgattcaagaataattgcttttatgataaaagaatttggatttgaaaat
agagcttttgctttttgttatggtcaaaaaaatgctgaagaggttaatgtaagtaaaaat
gtagcaaaaagattgggattagactggtattttattgaatataatgaacagtttataaat
gatattatatttagtgatcttttcaataaatatatagacttttataaagcttttggagta
actccgcatattcaggatcttttctctcttgtctggttaaaagataatggattattaaat
agcggtgatgtagttattccaggacattctggagattttttagctggtagtagattggta
tatacaaagaatattaatagtttatcttctttgaaaaaggcgattttaggttatcatgta
cagatttttagaataaagaaagatgtaaagattcatctggaaaatcgaattgatgaaatt
cataaaaatttcgatatgggttattcagatatttttgagatttttgactggcaagaacgt
caatcaaagtatattgctaattctgttagaaattatgaattttttgatttaaactggttt
ttgcctttatgggaaaaatctttatttgattttttttcttctcttgataattcacaacgc
tttcatgaaaagttatatcgcgaatctttaaatttgcttttcacaaaatatgatattgat
attaaaacaagtgatacaggaacgtcaaaaagtagagagacactgaaaaaatttgtttcc
ccggaaatgattatttttgcaaaaagaattgaagccattttaaagaataaagggaataaa
cataatttatacggaatttttgattttggaaaaattgaaaatagtgaaaatagatatatt
gaaatagttgggcatataacagaattattgattaattctttaagaagggaagaataa

DBGET integrated database retrieval system