KEGG   Marinitoga piezophila: Marpi_1548Help
Entry
Marpi_1548        CDS       T01665                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mpz  Marinitoga piezophila
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpz00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Marpi_1548
Enzymes [BR:mpz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Marpi_1548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1621294..1622061)
Genome map
AA seq 255 aa AA seqDB search
MLFKAYAKVNLYLDVVNKRSDGYHDILTLFQTIPIYDEIEIEFSEKEEFHSEPELNFPWE
KNIIKKAIDTFKKLTGYKFNLKIQLQKKLPQGGGIGGGSADAAAVLKFLKEHYNISDKDI
IEIGTKIGGDVPFLIFGGTAIAEGIGDKLTFLNPLNLNFEFNFPGIHVSTPEMYGEIDNN
WNELQRYGDPYKLYEALKEKNFMLARENAFNIFEQVVFKKYPELKKIKYDMSKKSVFSLM
SGSGSTIFAINKAQP
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgctatttaaagcatatgccaaggttaatctctatcttgatgttgttaataaacgatca
gatggatatcatgatatactcacattattccagacaattccaatatatgatgaaattgaa
atagaattttcagaaaaagaagaatttcactcagaaccagaattgaattttccctgggaa
aagaatattataaaaaaggctattgatacatttaaaaaactcacaggatataaatttaat
ctcaaaattcaattgcaaaaaaaacttcctcaaggtggcggaattggtggtggaagtgct
gatgctgcagctgtattaaaatttttaaaagaacattataatatttctgataaagacatt
attgaaatcggtacgaaaattggtggtgatgttccatttttaatatttggtggaacagca
attgctgaaggtatcggggataaacttacatttcttaatccattaaaccttaattttgaa
tttaattttccaggaatacatgtttcaacaccggaaatgtatggtgaaatagacaataac
tggaatgaattacaaagatatggagatccatacaagctttatgaagcattaaaagaaaaa
aattttatgttagccagagaaaatgcgtttaatatctttgaacaggttgtatttaaaaaa
tatcctgaactaaaaaaaataaaatatgatatgtcaaaaaaatctgtattttctttaatg
agcggctctggaagcactatattcgcaataaataaggcgcaaccttaa

DBGET integrated database retrieval system