KEGG   Marinitoga piezophila: Marpi_1548Help
Entry
Marpi_1548        CDS       T01665                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mpz  Marinitoga piezophila
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:mpz00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1621294..1622061)
Genome map
AA seq 255 aa AA seqDB search
MLFKAYAKVNLYLDVVNKRSDGYHDILTLFQTIPIYDEIEIEFSEKEEFHSEPELNFPWE
KNIIKKAIDTFKKLTGYKFNLKIQLQKKLPQGGGIGGGSADAAAVLKFLKEHYNISDKDI
IEIGTKIGGDVPFLIFGGTAIAEGIGDKLTFLNPLNLNFEFNFPGIHVSTPEMYGEIDNN
WNELQRYGDPYKLYEALKEKNFMLARENAFNIFEQVVFKKYPELKKIKYDMSKKSVFSLM
SGSGSTIFAINKAQP
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgctatttaaagcatatgccaaggttaatctctatcttgatgttgttaataaacgatca
gatggatatcatgatatactcacattattccagacaattccaatatatgatgaaattgaa
atagaattttcagaaaaagaagaatttcactcagaaccagaattgaattttccctgggaa
aagaatattataaaaaaggctattgatacatttaaaaaactcacaggatataaatttaat
ctcaaaattcaattgcaaaaaaaacttcctcaaggtggcggaattggtggtggaagtgct
gatgctgcagctgtattaaaatttttaaaagaacattataatatttctgataaagacatt
attgaaatcggtacgaaaattggtggtgatgttccatttttaatatttggtggaacagca
attgctgaaggtatcggggataaacttacatttcttaatccattaaaccttaattttgaa
tttaattttccaggaatacatgtttcaacaccggaaatgtatggtgaaatagacaataac
tggaatgaattacaaagatatggagatccatacaagctttatgaagcattaaaagaaaaa
aattttatgttagccagagaaaatgcgtttaatatctttgaacaggttgtatttaaaaaa
tatcctgaactaaaaaaaataaaatatgatatgtcaaaaaaatctgtattttctttaatg
agcggctctggaagcactatattcgcaataaataaggcgcaaccttaa

DBGET integrated database retrieval system