KEGG   Marinitoga piezophila: Marpi_1556Help
Entry
Marpi_1556        CDS       T01665                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mpz  Marinitoga piezophila
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mpz00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Marpi_1556
Enzymes [BR:mpz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Marpi_1556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1626975..1627598
Genome map
AA seq 207 aa AA seqDB search
MTKGILYVVSGPSGVGKSSIIKEAMKRLKGFTFSISYTTRKPRPGEVNGKDYFFVDEKTF
DEMVKNNEFLEYAEVHGHKYGTSKSFIKEKINEGFSIVLDIDVQGALNVVKQMRKETVLI
FIAPPSYSELKKRLLNRGTEKMEDLKRRLEDAKWELSKINEFDYLIVNEDLNESINQLIS
IFIAEQIKTERVTEHLGNYSFFKFEEE
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaggaatactttatgtcgttagtgggccaagtggagtaggtaaatcttcaatt
ataaaagaagcaatgaaaagacttaagggatttactttttccatttcatatacaacaaga
aaacctcgtcctggcgaagtaaatggaaaggattatttctttgtagatgaaaaaacattt
gatgaaatggtaaaaaataacgaatttcttgaatatgccgaagtgcatggtcataaatat
ggaacatcaaaaagttttataaaagaaaaaatcaatgaaggtttcagtatagtcctggat
attgatgttcagggtgcattaaatgtggtaaaacaaatgagaaaagaaacagttcttata
tttattgcaccaccatcatattctgaattaaaaaagcgtcttttaaatcgaggaacagaa
aagatggaagatcttaaaagacgtcttgaagatgcaaaatgggaattatctaaaataaat
gaatttgattatctaatagtaaatgaggatttaaacgaatcaatcaaccaattaatttca
atatttatagctgaacaaataaagactgaaagggttaccgaacatcttggtaattattca
ttctttaaatttgaggaggaatga

DBGET integrated database retrieval system