KEGG   Marinitoga piezophila: Marpi_1564Help
Entry
Marpi_1564        CDS       T01665                                 

Definition
(GenBank) 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
mpz  Marinitoga piezophila
Pathway
mpz00010  Glycolysis / Gluconeogenesis
mpz00020  Citrate cycle (TCA cycle)
mpz00620  Pyruvate metabolism
mpz00640  Propanoate metabolism
mpz00650  Butanoate metabolism
mpz00680  Methane metabolism
mpz01100  Metabolic pathways
mpz01120  Microbial metabolism in diverse environments
mpz01130  Biosynthesis of antibiotics
mpz01200  Carbon metabolism
Module
mpz_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mpz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Marpi_1564
   00020 Citrate cycle (TCA cycle)
    Marpi_1564
   00620 Pyruvate metabolism
    Marpi_1564
   00640 Propanoate metabolism
    Marpi_1564
   00650 Butanoate metabolism
    Marpi_1564
  Energy metabolism
   00680 Methane metabolism
    Marpi_1564
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Marpi_1564
Enzymes [BR:mpz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Marpi_1564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR
Motif
Other DBs
NCBI-ProteinID: AEX85954
UniProt: H2J4L2
Position
1633245..1633820
Genome map
AA seq 191 aa AA seqDB search
MPEKYFEIRWHGRAGQGAKSASQFLTEAAVEAGKYSTAFPEYGAERSGAPMKAFNRIADV
PIRIRSGIENPDVVVVFDDTMLGLPDITAGLGEDKIMLVNTVMSPEEVREKTGFKGKIYT
IPATDIALEEIKRGIPNTVMIGALVKLTNVVPMEVVKEKVRKTFEKKFSEEVVQANLRAV
DRGYQEVKGDA
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
gtgccagaaaaatactttgaaatcagatggcatggaagagctggtcagggtgcaaaaagt
gcttctcagtttttaacagaagctgcagtagaagcaggaaaatactcaacagcattccca
gaatacggtgcagaaagatcaggagcaccaatgaaagcatttaacagaattgctgatgtt
ccaattagaataagaagcggtattgaaaatccagatgttgttgttgtattcgatgatact
atgttaggattgccagatattacagctggtctcggtgaagataagattatgttggttaac
acagttatgtcaccagaagaagtaagagaaaaaacaggattcaagggaaaaatatataca
attccagcaacagatatagcattagaagaaataaaaagaggtattccaaatacagttatg
attggagctcttgttaaattgacaaatgttgttccaatggaagttgtaaaggaaaaggtt
agaaaaacatttgaaaagaaattctccgaagaagtagttcaagcaaacttaagagctgtt
gaccgcggttatcaggaggtgaaaggcgatgcctaa

DBGET integrated database retrieval system