KEGG   Marinitoga piezophila: Marpi_1564Help
Entry
Marpi_1564        CDS       T01665                                 

Definition
(GenBank) 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family
  KO
K00172  
pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
mpz  Marinitoga piezophila
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mpz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Marpi_1564
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Marpi_1564
   00020 Citrate cycle (TCA cycle)
    Marpi_1564
   00620 Pyruvate metabolism
    Marpi_1564
   00640 Propanoate metabolism
    Marpi_1564
   00650 Butanoate metabolism
    Marpi_1564
  Energy metabolism
   00680 Methane metabolism
    Marpi_1564
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Marpi_1564
Enzymes [BR:mpz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Marpi_1564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1633245..1633820
Genome map
AA seq 191 aa AA seqDB search
MPEKYFEIRWHGRAGQGAKSASQFLTEAAVEAGKYSTAFPEYGAERSGAPMKAFNRIADV
PIRIRSGIENPDVVVVFDDTMLGLPDITAGLGEDKIMLVNTVMSPEEVREKTGFKGKIYT
IPATDIALEEIKRGIPNTVMIGALVKLTNVVPMEVVKEKVRKTFEKKFSEEVVQANLRAV
DRGYQEVKGDA
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
gtgccagaaaaatactttgaaatcagatggcatggaagagctggtcagggtgcaaaaagt
gcttctcagtttttaacagaagctgcagtagaagcaggaaaatactcaacagcattccca
gaatacggtgcagaaagatcaggagcaccaatgaaagcatttaacagaattgctgatgtt
ccaattagaataagaagcggtattgaaaatccagatgttgttgttgtattcgatgatact
atgttaggattgccagatattacagctggtctcggtgaagataagattatgttggttaac
acagttatgtcaccagaagaagtaagagaaaaaacaggattcaagggaaaaatatataca
attccagcaacagatatagcattagaagaaataaaaagaggtattccaaatacagttatg
attggagctcttgttaaattgacaaatgttgttccaatggaagttgtaaaggaaaaggtt
agaaaaacatttgaaaagaaattctccgaagaagtagttcaagcaaacttaagagctgtt
gaccgcggttatcaggaggtgaaaggcgatgcctaa

DBGET integrated database retrieval system