KEGG   Marinitoga piezophila: Marpi_1565Help
Entry
Marpi_1565        CDS       T01665                                 

Definition
(GenBank) 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family
  KO
K00171  
pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
mpz  Marinitoga piezophila
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mpz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Marpi_1565
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Marpi_1565
   00020 Citrate cycle (TCA cycle)
    Marpi_1565
   00620 Pyruvate metabolism
    Marpi_1565
   00640 Propanoate metabolism
    Marpi_1565
   00650 Butanoate metabolism
    Marpi_1565
  Energy metabolism
   00680 Methane metabolism
    Marpi_1565
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Marpi_1565
Enzymes [BR:mpz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Marpi_1565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1633813..1634121
Genome map
AA seq 102 aa AA seqDB search
MPKYDSWKEMPIAGVIDKPATAREYNTGTWRVMRPIVDKDACINCMQCWLYCPDMAIDGK
VKEDGKTEMIGFNYTYCKGCGTCAEVCPVNAITMKPETEFLK
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaatacgatagctggaaagaaatgccaattgctggtgtaatagataaaccagca
acagcaagagaatacaatacaggtacatggagagtaatgagaccaattgtagataaagat
gcatgtataaattgtatgcaatgttggttatactgtccagacatggcaatagatggaaaa
gtaaaagaagatggaaaaacagaaatgataggcttcaactacacatattgtaaaggttgt
ggaacatgtgcagaagtatgtcctgtaaatgcaattacaatgaagcctgaaacggaattt
ttaaaataa

DBGET integrated database retrieval system