KEGG   Marinitoga piezophila: Marpi_1565Help
Entry
Marpi_1565        CDS       T01665                                 

Definition
(GenBank) 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
mpz  Marinitoga piezophila
Pathway
mpz00010  Glycolysis / Gluconeogenesis
mpz00020  Citrate cycle (TCA cycle)
mpz00620  Pyruvate metabolism
mpz00640  Propanoate metabolism
mpz00650  Butanoate metabolism
mpz00680  Methane metabolism
mpz01100  Metabolic pathways
mpz01120  Microbial metabolism in diverse environments
mpz01130  Biosynthesis of antibiotics
mpz01200  Carbon metabolism
Module
mpz_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mpz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Marpi_1565
   00020 Citrate cycle (TCA cycle)
    Marpi_1565
   00620 Pyruvate metabolism
    Marpi_1565
   00640 Propanoate metabolism
    Marpi_1565
   00650 Butanoate metabolism
    Marpi_1565
  Energy metabolism
   00680 Methane metabolism
    Marpi_1565
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Marpi_1565
Enzymes [BR:mpz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Marpi_1565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_16 Fer4_6 Fer4_9 Fer4_7 Fer4_10 Fer4_2 Fer4_4 Fer4_13 Fer4_8 Fer4_17 Fer4_15 Fer4_3 Fer4_22
Motif
Other DBs
NCBI-ProteinID: AEX85955
UniProt: H2J4L3
Position
1633813..1634121
Genome map
AA seq 102 aa AA seqDB search
MPKYDSWKEMPIAGVIDKPATAREYNTGTWRVMRPIVDKDACINCMQCWLYCPDMAIDGK
VKEDGKTEMIGFNYTYCKGCGTCAEVCPVNAITMKPETEFLK
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaatacgatagctggaaagaaatgccaattgctggtgtaatagataaaccagca
acagcaagagaatacaatacaggtacatggagagtaatgagaccaattgtagataaagat
gcatgtataaattgtatgcaatgttggttatactgtccagacatggcaatagatggaaaa
gtaaaagaagatggaaaaacagaaatgataggcttcaactacacatattgtaaaggttgt
ggaacatgtgcagaagtatgtcctgtaaatgcaattacaatgaagcctgaaacggaattt
ttaaaataa

DBGET integrated database retrieval system