KEGG   Marinitoga piezophila: Marpi_1567Help
Entry
Marpi_1567        CDS       T01665                                 

Definition
(GenBank) 2-oxoacid:ferredoxin oxidoreductase, beta subunit
  KO
K00170  
pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
mpz  Marinitoga piezophila
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mpz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Marpi_1567
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Marpi_1567
   00020 Citrate cycle (TCA cycle)
    Marpi_1567
   00620 Pyruvate metabolism
    Marpi_1567
   00640 Propanoate metabolism
    Marpi_1567
   00650 Butanoate metabolism
    Marpi_1567
  Energy metabolism
   00680 Methane metabolism
    Marpi_1567
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Marpi_1567
Enzymes [BR:mpz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Marpi_1567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1635322..1636296
Genome map
AA seq 324 aa AA seqDB search
MPVNLKQLINLVDKEDWPFTQGHRLCPGCNAPMVAKWATMTAKALGYEPVVGAATGCLEV
SSTIYPFTSWNIPYIHNAFENVAATISGAEAAYRSLKNRGRLKTDKPIKFIAFGGDGGTY
DIGLQSLSGAIERGHDFLYILYDNEGYMNTGNQRSGSTPPGADATTEPVGKVKNGKVQFK
KNIVEIIGAHENVYAATASTSDPFDFMAKVEKGLKHEGPAFIAVLAPCVRFWRIPESDGP
KITKLAVETKYWPLYEIDRGVYKITRKPRNFKPIEEYIRSIGRFRKALQHPEYQDMIAEM
QKYVDTRWERLLKLEEVTKDMYLR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgtaaatttaaagcaattaattaatttggtagataaagaagattggccatttaca
cagggacatagattatgtccaggatgtaacgcaccaatggtagcaaaatgggcaacaatg
acagcaaaagctttaggatatgaaccagtagtaggtgcagctacaggatgtttagaagtt
tcatcaacaatatatccatttacatcatggaatattccatacatccataacgcatttgaa
aatgtagcagcaacaatttctggtgcagaagctgcatatagatcattaaaaaacagagga
agattaaagacagataaaccaataaagtttatagcatttggtggagacggtggaacatac
gatataggtcttcaatcattatcaggtgcaattgaaagaggacatgatttcttatacatc
ctttatgataatgaaggttatatgaacacaggtaaccagagatcaggatcaacacctcca
ggtgcagacgcaacaacagaacctgttggtaaagttaaaaacggtaaagtacaatttaag
aaaaacattgttgaaataattggtgctcatgaaaacgtatatgctgcaacagcttcaact
tcagatccatttgattttatggcaaaagttgaaaaaggtttaaaacacgaaggtccagca
tttattgcagtattggcaccatgtgtaagattctggagaattcctgaaagtgatggtcca
aaaattacaaaattagcagtagaaacaaaatactggccattatacgaaattgatagagga
gtatataaaattacaagaaaaccaagaaacttcaaaccaattgaagaatatatcagatca
attggaagatttagaaaagcattacaacatcctgaatatcaggatatgatcgcagaaatg
caaaaatatgtagatacaagatgggaaagattattaaaacttgaagaagttacaaaagat
atgtacttaagataa

DBGET integrated database retrieval system