KEGG   Marinitoga piezophila: Marpi_1574Help
Entry
Marpi_1574        CDS       T01665                                 

Definition
chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mpz  Marinitoga piezophila
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mpz00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Marpi_1574
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Marpi_1574
Enzymes [BR:mpz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Marpi_1574
Two-component system [BR:mpz02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Marpi_1574
Bacterial motility proteins [BR:mpz02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Marpi_1574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1644511..1645557)
Genome map
AA seq 348 aa AA seqDB search
MDDKVIKILIVDDSGFMRMVLKDIIEKQKDMKVVGIAKTGLEGVEKAIQLKPDVITMDVE
MPELNGLEAVKIIMKKRPTPIIMVSSLTSKDSEITIEALENGAVDFIQKPAGSVSWTFRT
VADELLEKIRNAAKVDVTKMTMRRIKPKKPRISTMLRGQKIVLIASSTGGPRSLDTIIPN
LPKGINVPVVVVQHMPPGFTNSLAKRLDKISELHVKEAEDNEELKPDTVYIAPGNYHLGL
KASGSKVYTFLDQSDKINNVRPAADFTFDLAAEIYKSNIIAAVLTGMGKDGAKGAFKIKH
YGGKIIAESKETCVVYGMPKAVVEENYADFVLPNYEIADKIVELLGGK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggatgataaagtaattaaaatattaatagtagacgattctggattcatgagaatggtt
ttaaaagacattattgaaaaacaaaaggatatgaaggtcgttggaatagccaaaacaggt
cttgaaggtgttgaaaaggctattcaattaaaaccagatgtaattacaatggatgtcgaa
atgccggaattaaacggtcttgaagctgtaaaaataattatgaaaaaaagacctacacct
attataatggttagtagtttaacttcaaaggattctgaaattacaattgaagcactggaa
aatggcgctgtagattttatacaaaaacctgccggaagcgtttcatggacattcaggact
gttgctgacgaattattggaaaaaataagaaatgctgcaaaggttgatgtgactaaaatg
actatgagaaggatcaaacctaaaaaaccaagaatatcaacaatgttaagaggacaaaag
attgttttaattgcttcttctactggtggcccaagatcattagatacaattattcctaac
ttaccaaaagggataaatgttccggtggttgttgttcagcacatgcctccaggatttacc
aattctctcgcaaaaagattggataagatttccgaattgcatgtaaaagaagctgaagac
aatgaagaattaaaaccagatactgtatatattgcacctggaaattaccatcttggttta
aaagcttccggaagcaaggtatatacattccttgatcaatcagataaaataaataatgtt
agacctgctgcagattttacatttgatcttgccgcagaaatttataaatcaaatataatt
gccgcagtattaacaggaatgggtaaagatggtgcaaaaggtgcatttaaaattaaacat
tatggcggaaaaataattgctgaatcaaaagaaacctgcgtagtatatggaatgcctaaa
gctgttgtcgaagaaaattatgcagattttgttcttccaaattatgaaatagcagataaa
atcgtagagttgttgggaggaaaataa

DBGET integrated database retrieval system