KEGG   Marinitoga piezophila: Marpi_1773Help
Entry
Marpi_1773        CDS       T01665                                 

Definition
holliday junction resolvasome, DNA-binding subunit
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mpz  Marinitoga piezophila
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mpz00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Marpi_1773
Enzymes [BR:mpz01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Marpi_1773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1845803..1846360
Genome map
AA seq 185 aa AA seqDB search
MIRKVRGKVEKLTPDEIIIESGNMFFESIPTYRILERCEIGKEYVFETHLEISEWNIAFY
MFYDDIERNIFLNLKKVSKLGGKSALKILQKIDVEQLINMIASQDVKGLSKLPGIGKKTA
ERIINELGENLETLPVSGESTKLKDALEALEALGFEKNKVFNVLKEIDIEKLTLENIITQ
ALKKL
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgattagaaaagtaagaggaaaagtggaaaaattaactccagacgaaataataatagaa
tctggaaatatgttttttgaaagtattccaacatacaggattttagaaagatgtgaaata
ggaaaagaatatgtgtttgaaacacatcttgaaatatcagaatggaacatagctttttat
atgttttatgatgatattgaaagaaatatatttcttaatttaaaaaaggtttcaaaactt
ggtggaaaaagtgcattgaaaattcttcagaaaatagatgtagaacaattaataaatatg
atagcttctcaggatgtaaagggattatctaaacttcctggaataggtaaaaaaacagca
gaaagaataatcaacgaattgggtgaaaatcttgaaaccttacctgtaagtggagaaagt
acaaaattaaaagatgctcttgaagctcttgaagctctgggatttgaaaaaaacaaagta
tttaatgtattaaaggaaatagatatagaaaaattgacgcttgagaatataattacacaa
gctttgaagaaattgtga

DBGET integrated database retrieval system