KEGG   Marinitoga piezophila: Marpi_1781Help
Entry
Marpi_1781        CDS       T01665                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
mpz  Marinitoga piezophila
Pathway
mpz00010  Glycolysis / Gluconeogenesis
mpz00030  Pentose phosphate pathway
mpz00051  Fructose and mannose metabolism
mpz00052  Galactose metabolism
mpz00680  Methane metabolism
mpz01100  Metabolic pathways
mpz01110  Biosynthesis of secondary metabolites
mpz01120  Microbial metabolism in diverse environments
mpz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mpz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Marpi_1781
   00030 Pentose phosphate pathway
    Marpi_1781
   00051 Fructose and mannose metabolism
    Marpi_1781
   00052 Galactose metabolism
    Marpi_1781
  Energy metabolism
   00680 Methane metabolism
    Marpi_1781
Enzymes [BR:mpz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Marpi_1781
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Marpi_1781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK BRX_N
Motif
Other DBs
NCBI-ProteinID: AEX86162
UniProt: H2J5U3
Position
1852937..1853947
Genome map
AA seq 336 aa AA seqDB search
MKRIAVLNVGGDCPGLNSAIRALVRKSAIEDIEVLGVYDGFKGFIEDRVFIMTKEHVSGI
LERGGTILGSSKFDPTKNPEDFKKLKDNFEKYQITAFVIMSGHTGTSIALKLSEEGMPSV
VIPATIDNDLPWTDFSIGFFTALETVTKTLDALHSTASAGHRVIVVEVAGDEAGWLATIG
GLTGGADYILIPEIEFNPENLLKNIKKRYDEGKKFSIVVVEEKCPLDEKLKDIKEKLPEG
STPSDIISKYIKEKLPTVECRNVNLGYMQRGGAPVSFDRLIATMFSTAAIEYVKKGKVNV
ALSLKGFEITDVPFSKELLENKDIEPKIYDMAKIFF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaatagctgttttgaatgtaggtggagattgtccgggattaaattctgcaatt
agagctttagtaagaaaatctgcaattgaagatattgaagtacttggagtatatgatggg
tttaagggatttattgaagatagggtatttataatgacaaaagaacacgtttcgggtatc
ctggaaagaggaggaactattttaggttcttcaaaattcgatcccacaaaaaatcctgaa
gactttaaaaaattgaaagataattttgaaaaataccagattacagcttttgttattatg
agtgggcatacaggaacatcaatagctttaaagctttctgaagaaggtatgccatctgta
gttattccagcaacaatagacaatgatcttccatggacagattttagcataggtttcttt
acagcattggaaactgttactaaaacattggatgcacttcattcaacagcaagtgcagga
catagagttattgttgttgaagttgcaggtgatgaagcaggatggcttgcaacaatagga
gggttaacaggaggagctgattatatacttataccagaaattgaatttaatccggaaaat
ttattaaaaaacataaagaaaagatacgatgaaggaaaaaaattctcaatagtagtagtt
gaagaaaaatgccctcttgacgaaaaattaaaggatataaaagaaaagttgccagaaggt
tcaaccccttcagacataatttcaaaatatataaaagaaaaattaccaacagtggaatgt
agaaatgtaaaccttggatacatgcaaagaggtggagcacctgtttcatttgataggctt
attgctacaatgttctcaacagcggcaatagaatatgttaaaaaaggaaaagttaatgta
gctttatctttaaaaggatttgaaattacagatgtaccattctcaaaagaattgttagaa
aataaagatattgaaccaaaaatatatgatatggctaaaatattcttttaa

DBGET integrated database retrieval system