KEGG   Marinitoga piezophila: Marpi_1781Help
Entry
Marpi_1781        CDS       T01665                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mpz  Marinitoga piezophila
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mpz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Marpi_1781
   01230 Biosynthesis of amino acids
    Marpi_1781
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Marpi_1781
   00030 Pentose phosphate pathway
    Marpi_1781
   00051 Fructose and mannose metabolism
    Marpi_1781
   00052 Galactose metabolism
    Marpi_1781
  Energy metabolism
   00680 Methane metabolism
    Marpi_1781
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Marpi_1781
Enzymes [BR:mpz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Marpi_1781
Protein phosphatases and associated proteins [BR:mpz01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Marpi_1781
Messenger RNA biogenesis [BR:mpz03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Marpi_1781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1852937..1853947
Genome map
AA seq 336 aa AA seqDB search
MKRIAVLNVGGDCPGLNSAIRALVRKSAIEDIEVLGVYDGFKGFIEDRVFIMTKEHVSGI
LERGGTILGSSKFDPTKNPEDFKKLKDNFEKYQITAFVIMSGHTGTSIALKLSEEGMPSV
VIPATIDNDLPWTDFSIGFFTALETVTKTLDALHSTASAGHRVIVVEVAGDEAGWLATIG
GLTGGADYILIPEIEFNPENLLKNIKKRYDEGKKFSIVVVEEKCPLDEKLKDIKEKLPEG
STPSDIISKYIKEKLPTVECRNVNLGYMQRGGAPVSFDRLIATMFSTAAIEYVKKGKVNV
ALSLKGFEITDVPFSKELLENKDIEPKIYDMAKIFF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaatagctgttttgaatgtaggtggagattgtccgggattaaattctgcaatt
agagctttagtaagaaaatctgcaattgaagatattgaagtacttggagtatatgatggg
tttaagggatttattgaagatagggtatttataatgacaaaagaacacgtttcgggtatc
ctggaaagaggaggaactattttaggttcttcaaaattcgatcccacaaaaaatcctgaa
gactttaaaaaattgaaagataattttgaaaaataccagattacagcttttgttattatg
agtgggcatacaggaacatcaatagctttaaagctttctgaagaaggtatgccatctgta
gttattccagcaacaatagacaatgatcttccatggacagattttagcataggtttcttt
acagcattggaaactgttactaaaacattggatgcacttcattcaacagcaagtgcagga
catagagttattgttgttgaagttgcaggtgatgaagcaggatggcttgcaacaatagga
gggttaacaggaggagctgattatatacttataccagaaattgaatttaatccggaaaat
ttattaaaaaacataaagaaaagatacgatgaaggaaaaaaattctcaatagtagtagtt
gaagaaaaatgccctcttgacgaaaaattaaaggatataaaagaaaagttgccagaaggt
tcaaccccttcagacataatttcaaaatatataaaagaaaaattaccaacagtggaatgt
agaaatgtaaaccttggatacatgcaaagaggtggagcacctgtttcatttgataggctt
attgctacaatgttctcaacagcggcaatagaatatgttaaaaaaggaaaagttaatgta
gctttatctttaaaaggatttgaaattacagatgtaccattctcaaaagaattgttagaa
aataaagatattgaaccaaaaatatatgatatggctaaaatattcttttaa

DBGET integrated database retrieval system