KEGG   Marinitoga piezophila: Marpi_1781Help
Entry
Marpi_1781        CDS       T01665                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mpz  Marinitoga piezophila
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:mpz01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mpz01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mpz00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:mpz00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mpz00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mpz00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:mpz00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1852937..1853947
Genome map
AA seq 336 aa AA seqDB search
MKRIAVLNVGGDCPGLNSAIRALVRKSAIEDIEVLGVYDGFKGFIEDRVFIMTKEHVSGI
LERGGTILGSSKFDPTKNPEDFKKLKDNFEKYQITAFVIMSGHTGTSIALKLSEEGMPSV
VIPATIDNDLPWTDFSIGFFTALETVTKTLDALHSTASAGHRVIVVEVAGDEAGWLATIG
GLTGGADYILIPEIEFNPENLLKNIKKRYDEGKKFSIVVVEEKCPLDEKLKDIKEKLPEG
STPSDIISKYIKEKLPTVECRNVNLGYMQRGGAPVSFDRLIATMFSTAAIEYVKKGKVNV
ALSLKGFEITDVPFSKELLENKDIEPKIYDMAKIFF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaatagctgttttgaatgtaggtggagattgtccgggattaaattctgcaatt
agagctttagtaagaaaatctgcaattgaagatattgaagtacttggagtatatgatggg
tttaagggatttattgaagatagggtatttataatgacaaaagaacacgtttcgggtatc
ctggaaagaggaggaactattttaggttcttcaaaattcgatcccacaaaaaatcctgaa
gactttaaaaaattgaaagataattttgaaaaataccagattacagcttttgttattatg
agtgggcatacaggaacatcaatagctttaaagctttctgaagaaggtatgccatctgta
gttattccagcaacaatagacaatgatcttccatggacagattttagcataggtttcttt
acagcattggaaactgttactaaaacattggatgcacttcattcaacagcaagtgcagga
catagagttattgttgttgaagttgcaggtgatgaagcaggatggcttgcaacaatagga
gggttaacaggaggagctgattatatacttataccagaaattgaatttaatccggaaaat
ttattaaaaaacataaagaaaagatacgatgaaggaaaaaaattctcaatagtagtagtt
gaagaaaaatgccctcttgacgaaaaattaaaggatataaaagaaaagttgccagaaggt
tcaaccccttcagacataatttcaaaatatataaaagaaaaattaccaacagtggaatgt
agaaatgtaaaccttggatacatgcaaagaggtggagcacctgtttcatttgataggctt
attgctacaatgttctcaacagcggcaatagaatatgttaaaaaaggaaaagttaatgta
gctttatctttaaaaggatttgaaattacagatgtaccattctcaaaagaattgttagaa
aataaagatattgaaccaaaaatatatgatatggctaaaatattcttttaa

DBGET integrated database retrieval system