KEGG   Marinitoga piezophila: Marpi_1805Help
Entry
Marpi_1805        CDS       T01665                                 

Definition
esterase/lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
mpz  Marinitoga piezophila
Brite
Enzymes [BR:mpz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Marpi_1805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1881897..1882670)
Genome map
AA seq 257 aa AA seqDB search
MFFDNIPENSHILYENSQPLFLEGGKTAVLIIHGYTGTPHEMYYLAHRLNEEGFTVYVPR
LPGHGTNFEDFLSTSWKDWLRRVTDAYIELNSKYEKVYITGLSMGGVLTLILASKFNPEK
IALAAPAIEASDWRLKFTPVLKFFTKKIKRKKVEHFEEEGLNKIAKEYWSYDCPPKAADL
YFLQKMAKRRLMSVKSDTLIIVSKKDKAVPMSVASTIKNKISSKVIETVVLEESPHVVTN
DIEKEKVADEIIKFFKK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgttttttgataatattccagaaaattcccatatactttatgaaaattctcaacctttg
tttttagaaggtggaaaaactgctgttttaattatacacggatatactggcactccacat
gaaatgtattatcttgctcatagactaaatgaggaaggatttactgtatatgtaccaaga
ttaccaggccacggaacaaattttgaagattttttaagtacttcatggaaagactggtta
agaagggttactgatgcatatatcgaattgaattcaaagtatgaaaaggtttacatcacc
ggactttctatgggaggagtattaacattaatacttgcatctaaatttaatcctgaaaag
attgcacttgcagcacctgccatagaagcgagcgattggagattaaaattcacccccgta
ttaaaattctttacaaaaaaaataaaaagaaaaaaggttgagcattttgaagaagaagga
ttaaataaaattgctaaagaatattggagctatgattgtcctccaaaagctgctgattta
tatttcttacaaaaaatggcaaagcgtaggcttatgagtgtaaaaagcgatacattaatt
attgtttcaaaaaaggataaagctgtaccaatgagtgtagccagtactataaaaaataaa
atctcttcaaaggttatagaaacagtggtattagaagaaagtcctcatgttgttactaat
gatattgaaaaggaaaaggttgctgatgaaattataaagttcttcaaaaaataa

DBGET integrated database retrieval system