KEGG   Marinitoga piezophila: Marpi_1853Help
Entry
Marpi_1853        CDS       T01665                                 

Definition
(GenBank) peptidase family protein
Organism
mpz  Marinitoga piezophila
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1928775..1929809)
Genome map
AA seq 344 aa AA seqDB search
MNELLKYLPEITELPGISGKEDKVREYIIEKIKDKVDEYHIDVMGNLIAKVSGKDSSKKI
MVLAHMDEVGFMVTKVNDDGTFHISPVGGVDPRVVFSQRLLVNGEIPGVIQVKPIHLQKP
EERKAKPDYSQFKVYTGLSKEEAKKKIKVGDMVTFDTKFYIEGDRAVSKAFDDRAGCALM
LNLIDKIEKEGKPQYDTYFAFVVQEEVGLRGSGVAAYQIKPDVALVLEGTTAGDFPLLDE
DKWATHLGNGPATFFMHSGVVLSKEIFEKIVSLAKENNIKLQFKMRTAGGTDARRLATTL
DGIPSGILAVPSRYIHSPNTIIDVNDYINAYKLVELLIFEGRII
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaacttctaaaatatcttccagaaataactgaattaccaggaatttccggaaaa
gaagataaagtaagagaatatataatcgaaaaaattaaagataaagttgatgaatatcat
atagatgttatgggaaatcttatagctaaggtttccggcaaggattcttcaaaaaagatt
atggttcttgctcatatggatgaagttggttttatggttacaaaggttaatgatgatgga
acttttcatatttctccggtaggtggagttgacccaagagttgtattttcacaaagattg
ttggttaatggcgaaatacctggagtaatacaggtaaaacccatacatcttcagaagcct
gaagaaagaaaagcaaaacctgactattcacaatttaaggtttatactggtttaagcaaa
gaagaagcaaagaaaaaaataaaggttggagatatggtaacttttgatacaaaattttat
atagaaggagacagagctgtttcaaaggcttttgatgacagagcaggttgtgcgttaatg
ttaaaccttattgataagattgaaaaagaaggaaaacctcaatatgatacatatttcgct
tttgttgttcaggaagaggttggactcaggggaagcggtgttgcagcttatcagataaaa
cctgatgttgctcttgttcttgaaggtacaacggcaggggattttccattgctcgatgag
gataaatgggctactcatcttggaaatggacctgctacattctttatgcattctggagtt
gttttatcaaaagaaatatttgaaaagattgtttctctggcaaaagaaaataatataaag
ttacaatttaagatgaggactgctggtggaacagacgcaagaagacttgccactacattg
gatggtattccttctggtatattggctgttccttcaagatatattcactcgccaaataca
atcatagatgtaaatgattatataaatgcttataaacttgttgaacttttaatctttgaa
gggaggattatttaa

DBGET integrated database retrieval system