KEGG   Marinitoga piezophila: Marpi_1854Help
Entry
Marpi_1854        CDS       T01665                                 

Definition
(GenBank) peptidase family protein
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
mpz  Marinitoga piezophila
Pathway
mpz00500  Starch and sucrose metabolism
mpz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Marpi_1854
Enzymes [BR:mpz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Marpi_1854
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M42 Peptidase_M28 Peptidase_M20 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: AEX86235
UniProt: H2J687
Position
complement(1929802..1930836)
Genome map
AA seq 344 aa AA seqDB search
MKTGEILKDLSNAFGVSMYENPVKEKIIEYAKKISTDVEIFDAGKGSLGLKLGNGEKRFA
LFAHMDEIGIVITKIVDEQFAMVHTIGGVDPRTLISKRVKFKTENGEKIGVVGMLAPHLQ
KPQHRSSSPDFDNIYIDFSISGGTKDIEVGDIGTVDIEAIELNGKISGKALDNRVGCVVL
LKTLEELKKFNLEGKSIYFLFNQGEEIGLKGAKRTAEDIAPEIGIVIDVTFGSDIPPYYE
KVEMGKGPAIALGPSMHNEETQKMIDTAKKYGINHQLEPAPMRSGTESDIVQIVKEGVKT
ILISIPILNMHSSAEVVDPSDIDTSAILIANYIANYLEEGENNE
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaggagagattttaaaggatttgagcaacgctttcggggtatccatgtatgag
aatcctgttaaggaaaaaattatagaatatgcaaaaaaaatctctacagatgtagagatt
tttgatgcaggaaagggttctcttggtttaaagcttggtaatggagaaaaaagatttgca
ttatttgcacacatggacgaaattggtatcgttattaccaaaattgtcgatgagcaattt
gcaatggttcacactattggaggtgtggatccaagaacattaatttcaaaacgcgtaaaa
ttcaaaacagaaaatggagaaaaaattggtgtcgttggaatgttagctccgcatcttcaa
aaacctcaacatcgttcttcttcgccagattttgataatatctatatagatttttcgatt
tctggtggaaccaaagacattgaggttggagatattggaactgtagatattgaagctata
gaattaaacggaaaaatttccggtaaagctttagataacagagttggatgtgttgtatta
ttaaaaacacttgaagaattaaagaaatttaatcttgaaggaaaaagcatatatttcctc
tttaatcagggtgaagaaattggtttgaaaggagcaaaaagaactgctgaggatattgct
cctgaaattggaatagttatagacgttacctttggtagcgatatacctccatattatgaa
aaggttgaaatgggcaaaggtccagctatcgcgcttggcccaagtatgcataatgaagag
actcaaaaaatgattgatacagcaaagaaatatggaattaatcatcaacttgaacctgct
ccaatgagaagtggaacagaatctgatattgtacagatagtaaaagaaggagttaaaact
attcttatttcaataccaatattaaatatgcattcttccgcagaggttgtagatccttct
gatatagatacgtcagctatattaatagcaaattatattgctaattatttagaagaaggt
gaaaataatgaatga

DBGET integrated database retrieval system