KEGG   Marinitoga piezophila: Marpi_2054Help
Entry
Marpi_2054        CDS       T01665                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
mpz  Marinitoga piezophila
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:mpz00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Marpi_2054
  Lipid metabolism
   00561 Glycerolipid metabolism
    Marpi_2054
   00600 Sphingolipid metabolism
    Marpi_2054
Enzymes [BR:mpz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Marpi_2054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2162488..2164074)
Genome map
AA seq 528 aa AA seqDB search
MKIFNMSYENNYFEIQKDNYMVLLKMEEIPEGYILRGKIKGKIDKINIFEDIIDENIIVN
DWHSWGETKSINIKDYPEINSDYFILSEKKLIGFLSSNISHNYFEVKNTTVYGYMNFFEK
KLDDYIDFDPLIIIEGKNPEDLLEIYADYVKFENNIKLNKKRPVGWSSWYQYFDKLNWED
VKKNLELSQKYGYEVFQIDDSWQKDIGDWESKNNFPSLKEMAEKIKSHNMTPGIWTAPFN
VSETSQIFINHQDWLIKDENGNPKIAYKNWNKNIYTLDITNPDVQKHLYTLFKNMYNAGF
EYFKIDFLYSGAIEGKRFDNNITPIESYRKGLEIIRYAVKDSFILGCGAPLLPSLGYVDG
MRVSEDTAPIYTTDESVKLNAYIALKNSINRFFMNEKWWWNDPDCLILRKKDTQLDSIVR
QMYGYATGLLNYMIIQSDNLSLDIEEDIYFKVLELQGGIVKVKGIMDGNYIIESIHPKYG
KITLKMNLEEKRYNITFEDNIISLNKKTIVNEDKRLFHFYTLEGENNA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatttttaatatgagttacgaaaataattattttgaaattcaaaaagataattat
atggttttattaaaaatggaagaaattcctgaaggatatattctcagaggaaaaataaaa
ggaaaaattgacaaaataaacatctttgaggatattatagatgaaaatattatcgtcaat
gattggcatagctggggtgaaacaaaaagtataaacataaaggattatccggaaataaat
tcagattattttattctttctgaaaaaaaattaataggatttttatcctcaaatatttct
cataattactttgaggtaaaaaatacaactgtctatggatacatgaatttctttgaaaaa
aaattagatgattatattgattttgaccctttaataattattgaaggaaaaaatccggaa
gatttacttgaaatatatgctgattatgtaaagtttgaaaataatataaaattgaataaa
aaaagacctgtaggatggtcttcatggtatcaatattttgacaaattaaactgggaggat
gtgaaaaaaaatcttgaattatcccaaaaatatggttatgaagtatttcaaatagatgat
tcatggcaaaaagatattggcgactgggaatcaaaaaataatttcccatctttaaaagaa
atggcagaaaaaataaaatcacataatatgacgcctggaatctggaccgcgccattcaat
gtttctgaaacatctcaaatatttataaatcaccaggattggctcataaaagatgaaaat
ggaaatccaaagatagcttataaaaactggaataaaaacatctatacacttgatataaca
aatcctgatgtacaaaaacatctatatacattatttaaaaatatgtataatgccggtttc
gaatacttcaaaatagactttctctattcaggtgcaatagaaggaaaaagatttgataat
aatataactccaattgaaagctacagaaaaggactagagataataagatatgcagtaaaa
gattctttcatattaggttgtggtgctccattattaccttctcttggttatgtagatgga
atgagggttagtgaagatacagcgcctatatataccacagatgaatctgtaaaattaaat
gcatatatcgctttaaaaaacagcattaacaggtttttcatgaatgaaaaatggtggtgg
aatgatccagattgtttaatcttaagaaaaaaggatactcaattggattcaattgttcgc
cagatgtatggttatgccacaggattattgaattatatgattatacaaagcgataatctc
tctctggatattgaagaagatatatactttaaagtattagagcttcaaggtggaatagta
aaagtaaaaggtattatggacggaaattatattatagagtcaattcatccaaaatatgga
aagataacactaaaaatgaaccttgaagaaaaaagatataatataacatttgaagacaat
attatttcattaaacaagaaaacaatagtcaatgaggataaaagactgttccatttttat
acattagaaggtgaaaataatgcttga

DBGET integrated database retrieval system