KEGG   Mycobacterium tuberculosis H37Ra: MRA_0064Help
Entry
MRA_0064          CDS       T00540                                 

Gene name
celA1
Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mra  Mycobacterium tuberculosis H37Ra
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mra00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
66910..68052
Genome map
AA seq 380 aa AA seqDB search
MTRRTGQRWRGTLPGRRPWTRPAPATCRRHLAFVELRHYFARVMSSAIGSVARWIVPLLG
VAAVASIGVIADPVRVVRAPALILVDAANPLAGKPFYVDPASAAMVAARNANPPNAELTS
VANTPQSYWLDQAFPPATVGGTVARYTGAAQAAGAMPVLTLYGIPHRDCGSYASGGFATG
TDYRGWIDAVASGLGSSPATIIVEPDALAMADCLSPDQRQERFDLVRYAVDTLTRDPAAA
VYVDAGHSRWLSAEAMAARLNDVGVGRARGFSLNVSNFYTTDEEIGYGEAISGLTNGSHY
VIDTSRNGAGPAPDAPLNWCNPSGRALGAPPTTATAGAHADAYLWIKRPGESDGTCGRGE
PQAGRFVSQYAIDLAHNAGQ
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgtcggactgggcagcgatggcgcgggactctgcccgggcgccggccttggaca
cggccagcgcccgccacctgtcgtcggcatttggcgtttgtcgaattgcggcattatttt
gctcgggtgatgtcatcagctattggttcggtcgcgcggtggatagtccccctcctgggg
gttgcagccgttgcttccatcggtgttatcgcggacccggtgcgggtcgttcgggccccg
gcgttgatcctggtcgatgcggcaaacccgctggccggaaagcccttctacgtcgatccc
gcctcggcggccatggtcgccgcgcgcaacgccaacccgccgaacgccgagctgacctcc
gtcgccaacaccccgcagtcctactggctcgaccaggcattcccgccggcgaccgtcggc
ggcacggttgccaggtacaccggagcggcgcaggcggccggcgccatgccggttctgacg
ctgtatggaatcccccatcgcgactgcggtagctacgcatccggtgggttcgcgacgggc
actgattaccgcgggtggatcgacgctgtcgcatccggcctgggctcatcgccggcgacg
atcatcgtcgaacccgatgcgctggccatggccgactgcctgtcgcctgaccagcgccag
gaacgtttcgacttggtgcgctacgccgtcgacacgctgacccgcgacccggccgctgcc
gtgtacgtcgatgcggggcattcgcgctggctgagcgccgaggcaatggccgccaggctc
aacgatgtcggtgtgggccgcgcgcgcgggtttagcctcaacgtctcgaacttctacacc
accgatgaggaaatcggctatggcgaggcgatttcggggctcacgaacggttcgcattac
gtgatcgacacgtcgcgcaacggcgccggacccgcgcccgacgccccgctcaactggtgt
aaccccagcggccgcgccctgggcgcaccgcccaccacggcgaccgcgggcgcgcacgcc
gacgcttacctgtggatcaaacgtcccggggaatcggacggaacctgcggtcgcggggag
cctcaggcgggtcggttcgttagccagtacgccatcgatctggcccacaacgccggccag
tag

DBGET integrated database retrieval system