KEGG   Mycobacterium tuberculosis H37Ra: MRA_0170Help
Entry
MRA_0170          CDS       T00540                                 

Gene name
adhE1
Definition
zinc-type alcohol dehydrogenase subunit E
Organism
mra  Mycobacterium tuberculosis H37Ra
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(193344..194495)
Genome map
AA seq 383 aa AA seqDB search
MPAVQPWLYSNMPAIRGAVLDQIGVPRPYWRSKPISVVELHLDPPDRGEVLVRIEAAGVC
HSDLSVVDGTRVRPVPILLGHEAAGIVEQVGDGVDGVAVGQRVVLVFLPRCGQCAACATD
GRTPCEPGSAANKAGTLLGGGIRLSRGGRPVYHHLGVSGFATHVVVNRASVVPVPHEVPP
TVAALLGCAVLTGGGAVLNVGDPQPGQSVAVVGLGGVGMAAVLTALTYTDVRVVAVDQLP
EKLSAAKALGAHEIYTPQQATAGGVKAAVVVEAVGHPAALHTAIGLTAPGGRTITVGLPP
PDVRISLSPLDFVTEGRSLIGSYLGSAVPSHDIPRFVSLWQSGRLPVESLVTSTIRLDDI
NEAMDHLADGIAVRQLISFTGDL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
gtgccggcagtgcagccatggttgtattccaacatgcctgccatccggggcgcggtgcta
gaccagatcggtgtgccgcggccctattggcggtcgaaaccaatcagcgtcgtcgagctg
cacctggacccgcccgaccgcggtgaggtccttgtccgaatcgaggctgcgggcgtgtgc
cactccgacctgtcggtggtcgacggcacccgggtacggccggtgccgatcttgctcggt
catgaagccgctggaatcgtcgagcaggtcggcgacggcgtcgacggggtcgcggtcggt
cagcgagtcgtgctggtgttccttccgcgttgcggccagtgcgcggcgtgcgcgaccgac
ggtcggacgccgtgcgaaccgggcagcgcggccaacaaggccggcacactgctcggtggc
ggtatccggctcagccggggcggccgcccggtgtaccaccacctcggcgtctcgggtttc
gcgacccatgtcgtcgtcaaccgggccagcgtggttccggtgccgcacgaggtgccgccc
accgtcgctgccctactcgggtgcgcggtgctcaccggtgggggtgcggtactcaacgtc
ggtgatccgcagcccggccagtcggtcgccgtcgtcggcctcgggggcgtcggtatggca
gcggtgctcaccgctttgacgtatacagacgttcgtgtggtcgccgtcgatcagctaccc
gaaaagctgtcggccgcaaaggccttgggcgcccatgagatctacacaccgcagcaggcc
acggccggcggggtcaaagccgccgtggttgtcgaagccgtcggtcatcctgccgcgctg
cacaccgcgatcgggcttaccgcgcccggagggcgcaccatcaccgtcgggttgccgcca
ccggatgtccggatcagcttgtcgccgttggattttgtcaccgaaggccggtcactgatc
ggcagctatctgggttcggcggtgcccagccacgacattccccgcttcgtgtcgttgtgg
caatcgggccgtctgccggtggagtcgctggtgacgtcaacgattcggttggacgatatc
aacgaggcgatggaccacctcgccgatggcatcgcggtgcgtcagctcatcagtttcacc
ggtgatctctaa

DBGET integrated database retrieval system