KEGG   Mycobacterium tuberculosis H37Ra: MRA_0170Help
Entry
MRA_0170          CDS       T00540                                 

Gene name
adhE1
Definition
zinc-type alcohol dehydrogenase subunit E
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
mra  Mycobacterium tuberculosis H37Ra
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mra00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MRA_0170 (adhE1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MRA_0170 (adhE1)
  Lipid metabolism
   00071 Fatty acid degradation
    MRA_0170 (adhE1)
  Amino acid metabolism
   00350 Tyrosine metabolism
    MRA_0170 (adhE1)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MRA_0170 (adhE1)
   00626 Naphthalene degradation
    MRA_0170 (adhE1)
Enzymes [BR:mra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MRA_0170 (adhE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(193344..194495)
Genome map
AA seq 383 aa AA seqDB search
MPAVQPWLYSNMPAIRGAVLDQIGVPRPYWRSKPISVVELHLDPPDRGEVLVRIEAAGVC
HSDLSVVDGTRVRPVPILLGHEAAGIVEQVGDGVDGVAVGQRVVLVFLPRCGQCAACATD
GRTPCEPGSAANKAGTLLGGGIRLSRGGRPVYHHLGVSGFATHVVVNRASVVPVPHEVPP
TVAALLGCAVLTGGGAVLNVGDPQPGQSVAVVGLGGVGMAAVLTALTYTDVRVVAVDQLP
EKLSAAKALGAHEIYTPQQATAGGVKAAVVVEAVGHPAALHTAIGLTAPGGRTITVGLPP
PDVRISLSPLDFVTEGRSLIGSYLGSAVPSHDIPRFVSLWQSGRLPVESLVTSTIRLDDI
NEAMDHLADGIAVRQLISFTGDL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
gtgccggcagtgcagccatggttgtattccaacatgcctgccatccggggcgcggtgcta
gaccagatcggtgtgccgcggccctattggcggtcgaaaccaatcagcgtcgtcgagctg
cacctggacccgcccgaccgcggtgaggtccttgtccgaatcgaggctgcgggcgtgtgc
cactccgacctgtcggtggtcgacggcacccgggtacggccggtgccgatcttgctcggt
catgaagccgctggaatcgtcgagcaggtcggcgacggcgtcgacggggtcgcggtcggt
cagcgagtcgtgctggtgttccttccgcgttgcggccagtgcgcggcgtgcgcgaccgac
ggtcggacgccgtgcgaaccgggcagcgcggccaacaaggccggcacactgctcggtggc
ggtatccggctcagccggggcggccgcccggtgtaccaccacctcggcgtctcgggtttc
gcgacccatgtcgtcgtcaaccgggccagcgtggttccggtgccgcacgaggtgccgccc
accgtcgctgccctactcgggtgcgcggtgctcaccggtgggggtgcggtactcaacgtc
ggtgatccgcagcccggccagtcggtcgccgtcgtcggcctcgggggcgtcggtatggca
gcggtgctcaccgctttgacgtatacagacgttcgtgtggtcgccgtcgatcagctaccc
gaaaagctgtcggccgcaaaggccttgggcgcccatgagatctacacaccgcagcaggcc
acggccggcggggtcaaagccgccgtggttgtcgaagccgtcggtcatcctgccgcgctg
cacaccgcgatcgggcttaccgcgcccggagggcgcaccatcaccgtcgggttgccgcca
ccggatgtccggatcagcttgtcgccgttggattttgtcaccgaaggccggtcactgatc
ggcagctatctgggttcggcggtgcccagccacgacattccccgcttcgtgtcgttgtgg
caatcgggccgtctgccggtggagtcgctggtgacgtcaacgattcggttggacgatatc
aacgaggcgatggaccacctcgccgatggcatcgcggtgcgtcagctcatcagtttcacc
ggtgatctctaa

DBGET integrated database retrieval system