KEGG   Mycobacterium tuberculosis H37Ra: MRA_0496Help
Entry
MRA_0496          CDS       T00540                                 

Gene name
gpm1
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mra  Mycobacterium tuberculosis H37Ra
Pathway
mra00010  Glycolysis / Gluconeogenesis
mra00260  Glycine, serine and threonine metabolism
mra00680  Methane metabolism
mra01100  Metabolic pathways
mra01110  Biosynthesis of secondary metabolites
mra01120  Microbial metabolism in diverse environments
mra01130  Biosynthesis of antibiotics
mra01200  Carbon metabolism
mra01230  Biosynthesis of amino acids
Module
mra_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mra_M00002  Glycolysis, core module involving three-carbon compounds
mra_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mra00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MRA_0496 (gpm1)
  Energy metabolism
   00680 Methane metabolism
    MRA_0496 (gpm1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MRA_0496 (gpm1)
Enzymes [BR:mra01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     MRA_0496 (gpm1)
Membrane trafficking [BR:mra04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    MRA_0496 (gpm1)
Exosome [BR:mra04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   MRA_0496 (gpm1)
  Exosomal proteins of melanoma cells
   MRA_0496 (gpm1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABQ72217
UniProt: A5TZL7
Structure
PDB: 

Jmol
Position
579736..580485
Genome map
AA seq 249 aa AA seqDB search
MANTGSLVLLRHGESDWNALNLFTGWVDVGLTDKGQAEAVRSGELIAEHDLLPDVLYTSL
LRRAITTAHLALDSADRLWIPVRRSWRLNERHYGALQGLDKAETKARYGEEQFMAWRRSY
DTPPPPIERGSQFSQDADPRYADIGGGPLTECLADVVARFLPYFTDVIVGDLRVGKTVLI
VAHGNSLRALVKHLDQMSDDEIVGLNIPTGIPLRYDLDSAMRPLVRGGTYLDPEAAAAGA
AAVAGQGRG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacactggcagcctggtgttgctgcgccacggcgagagcgactggaatgccctc
aacctgttcaccggctgggtcgatgtcggcctgacggacaagggccaggcagaggcggtt
cgaagcggcgagctgatcgcggaacacgacctattgcccgacgtgctctacacctcgttg
ctgcggcgcgcgatcaccaccgcgcatctggcgttggacagcgccgatcggctctggatt
cccgtgcggcgtagctggcggctcaacgaacgccactacggcgcgctgcagggtttggac
aaggccgagaccaaggcccgctatggcgaagagcagttcatggcctggcggcgcagctat
gacacgccgccgccgccgatcgagcggggcagtcagttcagccaggacgccgaccctcgt
tacgccgacatcggcggtggcccgctcaccgaatgtctggctgacgtggtcgcccggttt
ttgccatatttcaccgacgtcatcgttggcgacttgcgggtcggcaagacggtgctgatc
gttgcccacggcaactcgttgcgcgcgctggtcaagcacctggaccagatgtctgacgac
gaaatcgtcggactgaacatcccgaccggaattccgctgcgctacgacctggattccgcg
atgaggccgctggtgcgcggtggtacgtatctggacccggaggcggcagccgccggcgcc
gccgcggtggccggccagggccgcgggtaa

DBGET integrated database retrieval system