KEGG   Mycobacterium tuberculosis H37Ra: MRA_0638Help
Entry
MRA_0638          CDS       T00540                                 

Gene name
recD
Definition
exonuclease V alpha chain
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mra  Mycobacterium tuberculosis H37Ra
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mra00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MRA_0638 (recD)
Enzymes [BR:mra01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MRA_0638 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(721315..723042)
Genome map
AA seq 575 aa AA seqDB search
MKLTDVDFAVEASGMVRAFNQAGVLDVSDVHVAQRLCALAGESDERVALAVAVAVRALRA
GSVCVDLLSIARVAGHDDLPWPDPADWLAAVRASPLLADPPVLHLYDDRLLYLDRYWREE
EQVCADLLALLTSRRPAGVPDLRRLFPTGFDEQRRAAEIALSQGVTVLTGGPGTGKTTTV
ARLLALVAEQAELAGEPRPRIALAAPTGKAAARLAEAVRREMAKLDATDRARLGDLHAVT
LHRLLGAKPGARFRQDRQNRLPHNVIVVDETSMVSLTLMARLAEAVRPGARLILVGDADQ
LASVEAGAVLADLVDGFSVRDDALVAQLRTSHRFGKVIGTLAEAIRAGDGDAVLGLLRSG
EERIEFVDDEDPAPRLRAVLVPHALRLREAALLGASDVALATLDEHRLLCAHRDGPTGVL
HWNRRVQAWLAEETGQPPWTPWYAGRPLLVTANDYGLRVYNGDTGVVLAGPTGLRAVISG
ASGPLDVATGRLGDVETMHAMTIHKSQGSQVDEVTVLMPQEDSRLLTRELLYTAVTRAKR
KVRVVGSEASVRAAIARRAVRASGLRMRLQSTGCG
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
gtgaagctcaccgacgtcgattttgccgtcgaggcctccgggatggtgcgggccttcaac
caggccggtgtgctggacgtgtcggatgtgcatgtggcgcaacgtctctgtgcactggcc
ggggagagcgacgagcgggtggcgttggcggtagcggtggcggtccgcgcgctacgggcc
ggttcggtgtgtgtggatctgttgtcgatcgcgcgggttgctggacacgacgacctgccg
tggccggatccggcggactggttggcggcggtgcgggccagtccgttgctcgccgatcca
cccgtgctgcacctgtatgacgatcggctgctctatctggaccgctactggcgcgaagaa
gagcaggtgtgcgcggacctgctcgcgttgctgacatccaggcgaccggccggggtaccc
gacttgcggcgactgttcccgaccggctttgacgagcagcggcgcgcggcggaaatcgcg
ctctcgcaaggtgttacggtgttgactggcgggcctggcaccgggaagacgacgacggtc
gcgcggctgctggcgttggttgccgagcaggcggagctggccggtgagccgcggccgcgg
atcgcgctggccgcacccaccggcaaggcggcggcccggctggccgaggcggtacggcgc
gagatggccaagctcgacgccaccgaccgggcacggctcggcgacctgcacgcggtcacg
ctgcatcgtctgctgggtgccaaaccgggagcgcggtttcgccaggatcgccagaaccgg
ttgcctcacaacgtgatcgtggtcgacgagacctcgatggtgtcgctgacgctgatggcc
cggctggccgaggcggtgcgcccgggcgcccggttgatcctcgtcggcgatgccgaccag
ttggcgtcggtggaagccggagcggtgctggcggatttggtcgatggcttctcggtacgc
gacgacgcgctggtggcgcagctgcgaacgtcgcatcggttcggcaaggtgatcggtacc
ttggccgaagcgatccgggccggcgatggcgatgccgtactgggcctgctgcgctcgggt
gaggagcggatcgagttcgtcgacgacgaggatccggcgccgcggttgcgcgcggtgctg
gtgccacacgcgttgcggctgcgcgaggcggcgctgttgggtgcctccgacgtcgcgttg
gccaccctggacgagcaccggctgctgtgtgcgcatcgggacgggcccaccggcgtgctg
cactggaaccgccgggttcaagcctggctcgccgaggagaccggccagccgccctggacg
ccgtggtacgccgggcgtccgctgctggtgacggccaacgactacggccttcgcgtctac
aacggcgacaccggtgtcgtgctggccggccccaccggtctgcgggccgtcatttctggt
gcatccgggccacttgacgttgccaccggccgcctcggcgacgtcgagaccatgcacgcg
atgaccatccacaagagtcagggcagccaggtcgacgaggtgacggtgctgatgccgcaa
gaggattcgcggttgctgacccgggagttgctgtacaccgcggtgacccgggccaaacgc
aaggtccgggtggtcgggtccgaagcttcggtgcgggccgcgatcgcacgccgggcggtg
cgggccagcgggttgcggatgcggttacagtcgacggggtgtggctga

DBGET integrated database retrieval system