KEGG   Mycobacterium tuberculosis H37Ra: MRA_0683Help
Entry
MRA_0683          CDS       T00540                                 

Gene name
echA4
Definition
(GenBank) enoyl-CoA hydratase EchA4
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mra  Mycobacterium tuberculosis H37Ra
Pathway
mra00071  Fatty acid degradation
mra00280  Valine, leucine and isoleucine degradation
mra00281  Geraniol degradation
mra00310  Lysine degradation
mra00360  Phenylalanine metabolism
mra00362  Benzoate degradation
mra00380  Tryptophan metabolism
mra00410  beta-Alanine metabolism
mra00627  Aminobenzoate degradation
mra00640  Propanoate metabolism
mra00650  Butanoate metabolism
mra00903  Limonene and pinene degradation
mra00930  Caprolactam degradation
mra01100  Metabolic pathways
mra01110  Biosynthesis of secondary metabolites
mra01120  Microbial metabolism in diverse environments
mra01130  Biosynthesis of antibiotics
mra01212  Fatty acid metabolism
Module
mra_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mra00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MRA_0683 (echA4)
   00650 Butanoate metabolism
    MRA_0683 (echA4)
  Lipid metabolism
   00071 Fatty acid degradation
    MRA_0683 (echA4)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MRA_0683 (echA4)
   00310 Lysine degradation
    MRA_0683 (echA4)
   00360 Phenylalanine metabolism
    MRA_0683 (echA4)
   00380 Tryptophan metabolism
    MRA_0683 (echA4)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MRA_0683 (echA4)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MRA_0683 (echA4)
   00281 Geraniol degradation
    MRA_0683 (echA4)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MRA_0683 (echA4)
   00627 Aminobenzoate degradation
    MRA_0683 (echA4)
   00930 Caprolactam degradation
    MRA_0683 (echA4)
Enzymes [BR:mra01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MRA_0683 (echA4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 SDH_sah ACP_syn_III_C DUF3756
Motif
Other DBs
NCBI-ProteinID: ABQ72409
UniProt: A5U059
Position
774429..775367
Genome map
AA seq 312 aa AA seqDB search
MTHAIRPVDFDNLKTMTYEVTGRIARITFNRPEKGNAIIADTPLELSALVERADLDPGVH
VILVSGRGEGFCAGFDLSAYAEGSSSTGGGGAYQGTVLDGKTQAVNHLPNQPWDPMIDYQ
MMSRFVRGFASLMHADKPTVVKIHGYCVAGGTDIALHADQVIAAADAKIGYPPTRVWGVP
AAGLWAHRLGDQRAKRLLFTGDCITGAQAAEWGLAVEAPEPADLDERTERLVARIAALPV
NQLIMVKLALNSALLQQGVATSRMVSTVFDGAARHTPEGHAFVADAVEHGFRDAVRRRDE
PFGDYGRQASRV
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgacacacgcgatcaggccggtcgatttcgacaacctgaagacgatgacctatgaggtc
accggtcggattgcgcggatcaccttcaaccggccggagaagggcaacgcgatcatcgca
gacaccccgctggagttgtctgctctggtggagcgtgccgatctggatccaggcgtgcat
gtcattctggtgtccggtcgcggcgagggattctgtgccggcttcgacctgtccgcctac
gccgaggggtcgtcgtcgaccgggggcggcggcgcataccaaggcacggtgctagatggc
aagacccaggccgtcaaccacctaccgaaccagccgtgggacccgatgatcgactaccag
atgatgagccggttcgtgcgcggattcgccagtctgatgcatgccgacaagccgacggtg
gtcaagatccacggctactgcgtggccggcggcaccgacatcgcgctgcacgccgatcag
gtgatcgccgccgccgacgccaagatcggctacccgcccacccgggtgtggggggtgccg
gcggcgggcctgtgggcgcaccggctcggcgaccagcgggccaaacggctgctgttcacc
ggcgattgcatcaccggcgcgcaggccgccgagtggggcctggcggtcgaggcgccggag
ccggctgacctcgacgagcggaccgagcgactggtggcccggatcgccgcactgccggtc
aatcaattgatcatggtcaagctcgcgctcaattccgctctgctgcaacagggtgtggcc
accagcaggatggtcagcaccgtgttcgacggcgccgctcggcacacacccgaggggcac
gcgtttgtcgccgacgcggtcgagcacggcttccgggatgcggtgcggcgccgtgacgag
ccgtttggcgactacggccgtcaagcatcgcgggtgtaa

DBGET integrated database retrieval system