KEGG   Mycobacterium tuberculosis H37Ra: MRA_0951Help
Entry
MRA_0951          CDS       T00540                                 

Definition
(RefSeq) formamidopyrimidine-DNA-glycosylase
  KO
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mra  Mycobacterium tuberculosis H37Ra
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:mra00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    MRA_0951
Enzymes [BR:mra01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     MRA_0951
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     MRA_0951
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1055073..1055549
Genome map
AA seq 158 aa AA seqDB search
MAGTPQPRALGPDALDVSTDDLAGLLAGNTGRIKTVITDQKVIAGIGNAYSDEILHVAKI
SPFATAGKLSGAQLTCLHEAMASVLSDAVRRSVGQGAAMLKGEKRSGLRVHARTGLPCPV
CGDTVREVSFADKSFQYCPTCQTGGKALADRRMSRLLK
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
gtggccgggacgccgcagccgcgcgcgctcgggcccgatgcgctggacgtcagcaccgac
gacctggccgggctgttggccggcaacaccggccggatcaagaccgtcatcaccgaccag
aaggtaattgccggcatcggcaacgcctatagtgacgaaatcctgcacgtcgcgaagatc
tcgccgttcgccacggccggcaagttatccggcgcacagctcacctgcctgcatgaggcg
atggcgtcggtgctgtcggacgcggtgcgccggtccgtcggccagggcgcggccatgctc
aaaggggagaaacgttctgggcttcgagtacatgcgcgcaccgggttaccctgcccagtg
tgcggtgacaccgtgcgggaggtgtccttcgcggacaagtcttttcagtactgtccaacg
tgtcagaccggtggcaaggcgctggccgaccggcgtatgtcgcggctgctcaagtag

DBGET integrated database retrieval system