KEGG   Mycobacterium tuberculosis H37Ra: MRA_1084Help
Entry
MRA_1084          CDS       T00540                                 

Gene name
fadA3
Definition
(GenBank) beta-ketoacyl CoA thiolase FadA3
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mra  Mycobacterium tuberculosis H37Ra
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:mra00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MRA_1084 (fadA3)
   00630 Glyoxylate and dicarboxylate metabolism
    MRA_1084 (fadA3)
   00640 Propanoate metabolism
    MRA_1084 (fadA3)
   00650 Butanoate metabolism
    MRA_1084 (fadA3)
  Lipid metabolism
   00071 Fatty acid degradation
    MRA_1084 (fadA3)
   00072 Synthesis and degradation of ketone bodies
    MRA_1084 (fadA3)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MRA_1084 (fadA3)
   00310 Lysine degradation
    MRA_1084 (fadA3)
   00380 Tryptophan metabolism
    MRA_1084 (fadA3)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MRA_1084 (fadA3)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MRA_1084 (fadA3)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MRA_1084 (fadA3)
Enzymes [BR:mra01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MRA_1084 (fadA3)
Exosome [BR:mra04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MRA_1084 (fadA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1199465..1200682)
Genome map
AA seq 405 aa AA seqDB search
MPEAVIVSTARSPIGRAMKGSLVGMRPDDLAVQMVRAALDKVPALNPHQIDDLMMGCGLP
GGESGFNIARVVAVALGYDFLPGTTVNRYCSSSLQTTRMAFHAIKAGEGDAFISAGVETV
SRFAKGNSDSWPDTKNPLFDGAQERSAAAAAGADEWHDPRTDQKLPDIYIAMGQTAENVA
IMTGISREEQDRWGVRSQNRAEEAIKNGFFEREITPVTLPDGTTVSTDDGPRPGTTYEKV
SELKPAFRPNGTVTAGNACPLNDGAAAVVITSDTKAKELGLTPLARIVSTGVSGLSPEIM
GLGPIEASKKALERAGMAITDIDLVEINEAFAVQVLGSARELGIDEDKLNISGGAIALGH
PFGMTGARITTTLLNNLQTYDKTFGLETMCVGGGQGMAMVIERLA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgccagaagctgtcatcgtctcgactgcccgctcgccgattggccgggccatgaaagga
tcgctggtcggcatgcggcccgacgacctggccgtccagatggtgcgcgccgcgctcgac
aaggttccggcactgaacccccatcagatcgacgacctcatgatgggctgtggcctgcca
ggcggtgagtccggtttcaacatcgcccgtgtcgtcgccgtcgcgctcggctatgacttc
ctgccgggcaccacggtcaaccggtactgttcgtcgtcgctgcagaccacccggatggcc
ttccacgcgatcaaggccggtgagggcgacgcgttcatctccgcgggcgtggaaaccgtc
tcccggttcgccaagggaaactccgactcctggccggacaccaagaacccgctgttcgac
ggggctcaggaacgttcggccgcggcagccgccggcgccgacgaatggcacgatccccgc
accgatcagaagctgccggacatctatattgcgatgggccagaccgcggaaaacgtcgcc
atcatgaccggcatcagccgcgaagaacaggaccgctggggcgtgcgcagccagaaccgg
gccgaagaggcgatcaagaacgggttcttcgaacgagaaatcacgccggtcacccttccg
gacggcaccacggtcagcaccgacgacggcccgcgaccgggtaccacctacgaaaaggtc
agcgagctcaagccggctttccggccgaatggcaccgtgaccgcggggaatgcctgtccg
ctcaacgacggggccgccgcggtggtgatcaccagcgacaccaaggccaaggaattaggc
ttgacaccgctggcgcgcattgtgtccaccggggtcagcgggctgtccccggagatcatg
ggcttagggccgatcgaggcgtccaagaaggcgctggaaagagccgggatggcgatcacc
gacatcgacctggtcgagatcaacgaggccttcgcggtgcaggtcctgggctcggcgcgc
gagctgggcatcgacgaggacaagctcaacatctcaggtggcgcgatcgccctaggtcac
ccgttcggtatgacgggcgcgcgcatcaccaccacgctgttgaacaacctgcagacctac
gacaagacgttcggtctggaaaccatgtgtgtcggtggcggccagggcatggcgatggtg
atcgagcgcctcgcgtga

DBGET integrated database retrieval system