KEGG   Mycobacterium tuberculosis H37Ra: MRA_1216Help
Entry
MRA_1216          CDS       T00540                                 

Gene name
folP2
Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
mra  Mycobacterium tuberculosis H37Ra
Pathway
mra00790  Folate biosynthesis
mra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mra00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MRA_1216 (folP2)
Enzymes [BR:mra01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     MRA_1216 (folP2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind PspC
Motif
Other DBs
NCBI-ProteinID: ABQ72955
UniProt: A5U1Q5
Structure
PDB: 

Jmol
Position
1352501..1353457
Genome map
AA seq 318 aa AA seqDB search
MRSTPPASAGRSTPPALAGHSTPPALAGHSTLCGRPVAGDRALIMAIVNRTPDSFYDKGA
TFSDAAARDAVHRAVADGADVIDVGGVKAGPGERVDVDTEITRLVPFIEWLRGAYPDQLI
SVDTWRAQVAKAACAAGADLINDTWGGVDPAMPEVAAEFGAGLVCAHTGGALPRTRPFRV
SYGTTTRGVVDAVISQVTAAAERAVAAGVAREKVLIDPAHDFGKNTFHGLLLLRHVADLV
MTGWPVLMALSNKDVVGETLGVDLTERLEGTLAATALAAAAGARMFRVHEVAATRRVLEM
VASIQGVRPPTRTVRGLA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtgcgttcaacaccgccggcctcagccggtcgttcaacaccgccggcgttagccggccat
tcaacaccgccggcgttagccggccattcaacgctgtgcggccgtccagtcgcaggtgat
cgtgcgctgatcatggcgatcgtcaaccgcaccccggattcgttttacgacaagggtgcg
actttcagcgacgcggctgccagagacgcggtccaccgggccgtcgccgacggtgccgac
gtcatcgacgtcggcggtgtcaaagccggcccgggtgaacgcgtcgacgtcgacaccgag
atcacgcggctggtgccgttcatcgaatggctccgcggtgcttacccggaccagctgatc
agtgtcgacacctggcgcgcgcaggtggcgaaggcggcctgcgcggcgggggcggacctg
atcaacgacacctggggtggcgtcgacccggccatgcccgaggtggccgccgagttcggc
gcgggcctggtgtgtgcgcacaccggcggcgcgctgccacgcacgcgacccttccgggtg
agctacggtacgactacccgcggtgtggtggatgctgtgattagccaggtcacagccgcc
gccgagcgggccgtcgcggccggggtggcccgcgagaaggtgttgatcgacccggcacac
gacttcggcaagaacaccttccatgggctgctgctattgcgacacgtggccgatcttgtt
atgaccgggtggcccgtgctgatggctttgagcaacaaggacgttgtcggggagactctg
ggcgtggatttgaccgaacggcttgagggaacgctggcagccaccgcgttggctgcggcc
gccggggcgcgcatgtttcgggtgcatgaggtcgccgccacccggcgggtgctggaaatg
gtggcatcgattcagggggtccggccgccgacgcgcacggtgagaggactcgcatga

DBGET integrated database retrieval system