KEGG   Mycobacterium tuberculosis H37Ra: MRA_1873Help
Entry
MRA_1873          CDS       T00540                                 

Gene name
adhA
Definition
(GenBank) alcohol dehydrogenase AdhA
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mra  Mycobacterium tuberculosis H37Ra
Pathway
mra00010  Glycolysis / Gluconeogenesis
mra00071  Fatty acid degradation
mra00350  Tyrosine metabolism
mra00625  Chloroalkane and chloroalkene degradation
mra00626  Naphthalene degradation
mra01100  Metabolic pathways
mra01110  Biosynthesis of secondary metabolites
mra01120  Microbial metabolism in diverse environments
mra01130  Biosynthesis of antibiotics
mra01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mra00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MRA_1873 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    MRA_1873 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    MRA_1873 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MRA_1873 (adhA)
   00626 Naphthalene degradation
    MRA_1873 (adhA)
Enzymes [BR:mra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MRA_1873 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ABQ73629
UniProt: A5U3M9
Position
2119476..2120516
Genome map
AA seq 346 aa AA seqDB search
MVSPATTATMSAWQVRRPGPMDTGPLERVTTRVPRPAPSELLVAVHACGVCRTDLHVTEG
DLPVHRERVIPGHEVVGEVIEVGSAVGAAAGGEFDRGDRVGIAWLRHTCGVCKYCRRGSE
NLCPQSRYTGWDADGGYAEFTTVPAAFAHHLPSGYSDSELAPLLCAGIIGYRSLLRTELP
PGGRLGLYGFGGSAHITAQVALAQGAEIHVMTRGARARKLALQLGAASAQDAADRPPVPL
DAAILFAPVGDLVLPALEALDRGGILAIAGIHLTDIPDLNYQQHLFQERQIRSVTSNTRA
DARAFFDFAAQHHIEVTTPEYPLGQADRALGDLSAGRIAGAAVLLI
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggtctcaccggcgaccacggcgacgatgagtgcgtggcaggtgcgtcggcccggcccg
atggacaccggcccgctcgaacgagtgaccacccgggtgccgcgcccggcgccatcggag
ttgctggtggccgtgcacgcatgcggggtgtgccgcaccgatctccacgtgaccgaaggt
gacctgcccgtgcaccgcgaacgggtgattcccggccacgaggtagtgggagaggtcatt
gaggtgggctcagcggtgggcgcggctgccggtggcgaattcgaccgaggagaccgggtg
ggtatcgcctggctgcgtcacacttgcggggtctgcaagtactgccggcgcggcagcgag
aacctctgcccgcaatcccgctacaccggctgggacgccgacgggggatacgccgaattc
acgacggttcctgcggctttcgcgcaccatctgccgagcggctatagcgacagcgagctg
gcgccgttgttgtgcgccggcatcatcggatatcgatcgctgctgcgcaccgagctacca
cccggtggccggctgggtctctacggattcggcggcagtgcccacatcaccgcccaggtc
gcgttggcgcaaggcgccgaaatacatgtgatgacacgcggggcccgcgcgcgcaagctg
gcgctgcaacttggcgctgcatcggctcaggacgccgccgaccggccacccgtgccgctg
gacgccgcgatcttattcgccccggtcggggatctggtgctgcccgcgctggaagcgctg
gaccgtggcggcatcttggcgatcgccgggatccacctgacagatattccggacctgaac
taccagcagcacttgttccaggagcgtcagatccggtcggtcacgtcgaacacccgcgcc
gatgcgcgcgcgttcttcgacttcgccgcccagcatcacatcgaggtcaccacgccggag
tacccgcttggccaagccgatcgtgcgctgggcgacctgagcgccggccgcatcgccggt
gccgccgtgctgctgatctga

DBGET integrated database retrieval system