KEGG   Mycobacterium tuberculosis H37Ra: MRA_1916Help
Entry
MRA_1916          CDS       T00540                                 

Gene name
aao
Definition
D-amino acid oxidase
Organism
mra  Mycobacterium tuberculosis H37Ra
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2161365..2162327)
Genome map
AA seq 320 aa AA seqDB search
MAIGEQQVIVIGAGVSGLTSAICLAEAGWPVRVWAAALPQQTTSAVAGAVWGPRPKEPVA
KVRGWIEQSLHVFRDLAKDPATGVRMTPALSVGDRIETGAMPPGLELIPDVRPADPADVP
GGFRAGFHATLPMIDMPQYLDCLTQRLAATGCEIETRPLRSLAEAAEAAPIVINCAGLGA
RELAGDATVWPRFGQHVVLTNPGLEQLFIERTGGSEWICYFAHPQRVVCGGISIPGRWDP
TPEPEITERILQRCRRIQPRLAEAAVIETITGLRPDRPSVRVEAEPIGRALCIHNYGHGG
DGVTLSWGCAREVVNLVGGG
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtggcaataggtgagcaacaggtcatcgtgattggggccggcgtcagcggactgacgtcg
gccatatgcctggccgaggcggggtggccggtgcgggtatgggcggccgcattgccgcag
caaacgacatcggcggtggcgggtgcggtctgggggccgcggccgaaggaacccgttgcc
aaggtacgcgggtggatcgaacagtcattgcacgtgtttcgcgacttggccaaggatccc
gccaccggcgtgcgcatgacgccggcgctgagtgtcggcgatcgtatcgagaccggtgcg
atgccgcccgggttggagctgatccccgacgtgcggccggctgacccggccgacgtgccc
gggggcttccgtgctgggtttcatgccaccttgccgatgatcgatatgccccagtacctc
gactgtctgacccagcgattggcggcgactggctgtgaaatcgaaacgcgcccgctacgg
tcgctggccgaggccgctgaggcggcgcccatagtgatcaactgtgctggtctgggcgct
cgggaactggccggcgacgccacggtctggccgcggttcggccagcacgtcgtcctcacc
aatccaggtctagagcaactgtttatcgagcgcaccggcggctcggaatggatctgctac
tttgcccacccgcagcgtgtagtctgcggcggcatcagtatccctggcaggtgggacccc
accccagagccggagataaccgagcggatcctgcaacggtgtcgccgcatacaaccacgg
cttgccgaggcggcagtgattgagacgattaccgggctgcgtcctgatcggccgtccgtg
cgggtggaagctgaaccgatcgggcgagcgctgtgcatccacaactatggccacggaggt
gacggcgtgaccctgtcatggggttgtgcgcgggaggtggtcaatcttgtcggcggcggt
taa

DBGET integrated database retrieval system