KEGG   Mycobacterium tuberculosis H37Ra: MRA_2218Help
Entry
MRA_2218          CDS       T00540                                 

Gene name
cbhK
Definition
carbohydrate kinase CbhK
Orthology
K00856  
adenosine kinase [EC:2.7.1.20]
Organism
mra  Mycobacterium tuberculosis H37Ra
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mra00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2476955..2477929)
Genome map
AA seq 324 aa AA seqDB search
MTIAVTGSIATDHLMRFPGRFSEQLLPEHLHKVSLSFLVDDLVMHRGGVAGNMAFAIGVL
GGEVALVGAAGADFADYRDWLKARGVNCDHVLISETAHTARFTCTTDVDMAQIASFYPGA
MSEARNIKLADVVSAIGKPELVIIGANDPEAMFLHTEECRKLGLAFAADPSQQLARLSGE
EIRRLVNGAAYLFTNDYEWDLLLSKTGWSEADVMAQIDLRVTTLGPKGVDLVEPDGTTIH
VGVVPETSQTDPTGVGDAFRAGFLTGRSAGLGLERSAQLGSLVAVLVLESTGTQEWQWDY
EAAASRLAGAYGEHAAAEIVAVLA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
gtgacgatcgcggtaaccggttcgattgcgaccgaccatttgatgcggtttccaggccga
ttttccgagcagctactgcccgaacacctgcacaaggtgtcgcttagcttcctagtcgat
gacttggtgatgcaccgcggcggcgtggccggaaacatggccttcgccatcggtgtgcta
ggtggcgaggtcgcgctagttggggcggcaggcgccgacttcgccgattatcgcgactgg
ctgaaagcccgcggtgtcaactgcgaccacgttctgatctccgagaccgcgcacacggcg
cggtttacctgtaccaccgatgtcgacatggcccagatcgcatcgttctaccccggggct
atgtcggaggcacgtaacatcaagcttgccgacgtggtgtcggccatcggcaagccggag
ttggtgatcatcggcgccaacgaccccgaggcgatgttcttgcacaccgaggagtgtcgc
aagctggggctggccttcgccgccgatccgtctcagcagctggcgaggctgtcgggtgag
gaaattcgcaggctcgtcaacggtgctgcttacttgttcaccaacgactacgaatgggat
ctgctgctgtccaagaccggctggtcagaggccgatgtgatggcgcagatcgacctgcgg
gtgaccacattgggtcctaagggtgtcgatttggtagaacctgacggcaccaccatccac
gtcggcgtggtccccgaaaccagccagaccgaccccaccggcgtcggcgacgcgttccgc
gccggtttcctgactggccgcagtgccggactaggcctggagcgttcggcgcagctgggc
tcgctggttgccgtgctggtgctggagtcgaccggaactcaggagtggcagtgggattac
gaggccgcggccagcaggctggctggtgcttacggcgagcacgcggccgccgagatcgtc
gccgtgctggcctag

DBGET integrated database retrieval system