KEGG   Mycobacterium tuberculosis H37Ra: MRA_2462Help
Entry
MRA_2462          CDS       T00540                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mra  Mycobacterium tuberculosis H37Ra
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mra00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MRA_2462 (rbsK)
Enzymes [BR:mra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     MRA_2462 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
2745198..2746112
Genome map
AA seq 304 aa AA seqDB search
MANASETNVGPMAPRVCVVGSVNMDLTFVVDALPRPGETVLAASLTRTPGGKGANQAVAA
ARAGAQVQFSGAFGDDPAAAQLRAHLRANAVGLDRTVTVPGPSGTAIIVVDASAENTVLV
APGANAHLTPVPSAVANCDVLLTQLEIPVATALAAARAAQSADAVVMVNASPAGQDRSSL
QDLAAIADVVIANEHEANDWPSPPTHFVITLGVRGARYVGADGVFEVPAPTVTPVDTAGA
GDVFAGVLAANWPRNPGSPAERLRALRRACAAGALATLVSGVGDCAPAAAAIDAALRANR
HNGS
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacgccagtgagactaacgtcggccccatggcgccccgggtgtgcgtggtaggc
agcgtgaacatggacctgacgttcgtggtggacgcgcttccgcgccccggcgagacggtg
cttgcggcgtcgttgacccgaacgccaggcgggaagggcgccaaccaggcggtggccgca
gcgcgcgcaggcgcgcaggtacagttctccggtgcattcggcgacgatccagccgccgcc
cagctgcgggcccacctgcgcgccaacgccgttggactggacaggaccgtcacggtgccc
ggaccgagcgggacggcgattatcgtggtcgatgccagcgccgagaacaccgtgctggtg
gcgccgggtgccaatgcacatctgactccggtaccctcggccgtcgccaactgcgatgta
ctgttgacccagttggagattcctgttgcaaccgcgctggcagccgcgcgggcagcccag
tcggccgatgcggttgtcatggtcaacgcctccccagccggccaggatcgaagctccttg
caggacttggccgctatcgccgacgtggtgatcgccaacgagcatgaggcaaacgactgg
ccgtcgccaccaacacatttcgtgatcaccctgggtgtgcgcggtgcccggtacgtcggc
gcggacggggtgttcgaggtacccgccccaacggtaacgccagtggataccgccggcgcc
ggcgacgtatttgccggggtccttgctgcgaattggccgcgcaacccaggttcgccggcc
gagcgactgcgcgcattgcggcgggcctgcgctgcgggtgcgctggcaactttggtgtcc
ggtgtcggcgactgcgcaccggccgccgccgcgatcgatgcggccctgcgagccaaccgc
cacaacggttcatga

DBGET integrated database retrieval system