KEGG   Mycobacterium tuberculosis H37Ra: MRA_2608Help
Entry
MRA_2608          CDS       T00540                                 

Gene name
dhaA
Definition
haloalkane dehalogenase (EC:3.8.1.5)
Orthology
K01563  
haloalkane dehalogenase [EC:3.8.1.5]
Organism
mra  Mycobacterium tuberculosis H37Ra
Pathway
Chlorocyclohexane and chlorobenzene degradation
Chloroalkane and chloroalkene degradation
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mra00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MRA_2608 (dhaA)
   00361 Chlorocyclohexane and chlorobenzene degradation
    MRA_2608 (dhaA)
Enzymes [BR:mra01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.5  haloalkane dehalogenase
     MRA_2608 (dhaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
2915607..2916509
Genome map
AA seq 300 aa AA seqDB search
MTAFGVEPYGQPKYLEIAGKRMAYIDEGKGDAIVFQHGNPTSSYLWRNIMPHLEGLGRLV
ACDLIGMGASDKLSPSGPDRYSYGEQRDFLFALWDALDLGDHVVLVLHDWGSALGFDWAN
QHRDRVQGIAFMEAIVTPMTWADWPPAVRGVFQGFRSPQGEPMALEHNIFVERVLPGAIL
RQLSDEEMNHYRRPFVNGGEDRRPTLSWPRNLPIDGEPAEVVALVNEYRSWLEETDMPKL
FINAEPGAIITGRIRDYVRSWPNQTEITVPGVHFVQEDSPEEIGAAIAQFVRRLRSAAGV
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgacagcattcggcgtcgagccctacgggcagccgaagtacctagaaatcgccgggaag
cgcatggcgtatatcgacgaaggcaagggtgacgccatcgtctttcagcacggcaacccc
acgtcgtcttacttgtggcgcaacatcatgccgcacttggaagggctgggccggctggtg
gcctgcgatctgatcgggatgggcgcgtcggacaagctcagcccatcgggacccgaccgc
tatagctatggcgagcaacgagactttttgttcgcgctctgggatgcgctcgacctcggc
gaccacgtggtactggtgctgcacgactggggctcggcgctcggcttcgactgggctaac
cagcatcgcgaccgagtgcaggggatcgcgttcatggaagcgatcgtcaccccgatgacg
tgggcggactggccgccggccgtgcggggtgtgttccagggtttccgatcgcctcaaggc
gagccaatggcgttggagcacaacatctttgtcgaacgggtgctgcccggggcgatcctg
cgacagctcagcgacgaggaaatgaaccactatcggcggccattcgtgaacggcggcgag
gaccgtcgccccacgttgtcgtggccacgaaaccttccaatcgacggtgagcccgccgag
gtcgtcgcgttggtcaacgagtaccggagctggctcgaggaaaccgacatgccgaaactg
ttcatcaacgccgagcccggcgcgatcatcaccggccgcatccgtgactatgtcaggagc
tggcccaaccagaccgaaatcacagtgcccggcgtgcatttcgttcaggaggacagccca
gaggaaatcggtgcggccatagcacagttcgtccggcggctccggtcggcggccggcgtc
tga

DBGET integrated database retrieval system