KEGG   Mycobacterium tuberculosis H37Ra: MRA_2854Help
Entry
MRA_2854          CDS       T00540                                 

Gene name
echA16
Definition
(GenBank) enoyl-CoA hydratase EchA16
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mra  Mycobacterium tuberculosis H37Ra
Pathway
mra00071  Fatty acid degradation
mra00280  Valine, leucine and isoleucine degradation
mra00281  Geraniol degradation
mra00310  Lysine degradation
mra00360  Phenylalanine metabolism
mra00362  Benzoate degradation
mra00380  Tryptophan metabolism
mra00410  beta-Alanine metabolism
mra00627  Aminobenzoate degradation
mra00640  Propanoate metabolism
mra00650  Butanoate metabolism
mra00903  Limonene and pinene degradation
mra00930  Caprolactam degradation
mra01100  Metabolic pathways
mra01110  Biosynthesis of secondary metabolites
mra01120  Microbial metabolism in diverse environments
mra01130  Biosynthesis of antibiotics
mra01212  Fatty acid metabolism
Module
mra_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mra00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MRA_2854 (echA16)
   00650 Butanoate metabolism
    MRA_2854 (echA16)
  Lipid metabolism
   00071 Fatty acid degradation
    MRA_2854 (echA16)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MRA_2854 (echA16)
   00310 Lysine degradation
    MRA_2854 (echA16)
   00360 Phenylalanine metabolism
    MRA_2854 (echA16)
   00380 Tryptophan metabolism
    MRA_2854 (echA16)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MRA_2854 (echA16)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MRA_2854 (echA16)
   00281 Geraniol degradation
    MRA_2854 (echA16)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MRA_2854 (echA16)
   00627 Aminobenzoate degradation
    MRA_2854 (echA16)
   00930 Caprolactam degradation
    MRA_2854 (echA16)
Enzymes [BR:mra01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MRA_2854 (echA16)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 AMMECR1
Motif
Other DBs
NCBI-ProteinID: ABQ74633
UniProt: A5U6I3
Structure
PDB: 

Jmol
Position
3149263..3150012
Genome map
AA seq 249 aa AA seqDB search
MTDDILLIDTDERVRTLTLNRPQSRNALSAALRDRFFAALADAEADDDIDVVILTGADPV
FCAGLDLKELAGQTALPDISPRWPAMTKPVIGAINGAAVTGGLELALYCDILIASEHARF
ADTHARVGLLPTWGLSVRLPQKVGIGLARRMSLTGDYLSATDALRAGLVTEVVAHDQLLP
TARRVAASIVGNNQNAVRALLASYHRIDESQTAAGLWLEACAAKQFRTSGDTIAANREAV
LQRGRAQVR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgacatcctgctgatcgacaccgacgaacgggtgcgaaccctcaccctcaac
cggccgcagtcccgcaacgcgctctcggcggcgctacgggatcggtttttcgcggcgttg
gccgacgccgaggccgacgacgacatcgacgtcgtcatcctcaccggcgccgatccggtg
ttctgcgccggactggacctcaaggagctggccgggcagaccgcgctgccggacatctca
ccgcggtggccggccatgaccaagccggtgatcggcgcgatcaacggcgccgcggtcacc
ggcgggctcgaactggcgctgtactgcgacatcctgatcgcctccgagcacgcccgcttc
gccgacacccacgcccgggtgggcctgctgcccacctggggactcagcgtgcgcttgccg
caaaaggtcggcatcggcctggcccggcggatgagcctgaccggcgactacctgtccgcg
accgacgcgttgcgggccggcctggtcaccgaggtggtggcccacgaccagctgctgccc
accgcccgccgggtggcggcgtcgatcgtcggcaacaaccagaacgcggtgcgggcattg
ctggcgtcctaccaccgcatcgacgagtctcagaccgccgccgggctgtggctggaagcc
tgcgcggccaagcaatttcgcactagcggcgataccatcgccgccaaccgcgaagccgtg
ctgcagcgcggccgcgcgcaggtgcgttag

DBGET integrated database retrieval system