KEGG   Mycobacterium tuberculosis H37Ra: MRA_2950Help
Entry
MRA_2950          CDS       T00540                                 

Gene name
fpg
Definition
(GenBank) formamidopyrimidine-DNA glycosylase Fpg
  KO
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mra  Mycobacterium tuberculosis H37Ra
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:mra00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    MRA_2950 (fpg)
Enzymes [BR:mra01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     MRA_2950 (fpg)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     MRA_2950 (fpg)
DNA repair and recombination proteins [BR:mra03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     MRA_2950 (fpg)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3250593..3251462)
Genome map
AA seq 289 aa AA seqDB search
MPELPEVEVVRRGLQAHVTGRTITEVRVHHPRAVRRHDAGPADLTARLRGARINGTDRRG
KYLWLTLNTAGVHRPTDTALVVHLGMSGQMLLGAVPCAAHVRISALLDDGTVLSFADQRT
FGGWLLADLVTVDGSVVPVPVAHLARDPLDPRFDCDAVVKVLRRKHSELKRQLLDQRVVS
GIGNIYADEALWRAKVNGAHVAATLRCRRLGAVLHAAADVMREALAKGGTSFDSLYVNVN
GESGYFERSLDAYGREGENCRRCGAVIRRERFMNRSSFYCPRCQPRPRK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagctgcccgaagtcgaggtggtgcggcgcggcttgcaggctcacgtgaccggc
cggaccatcaccgaggttcgggtgcaccacccccgcgctgtgcgccgccacgatgccggg
cccgcggatctgacggcgcggctgcggggagcgcggatcaacggaaccgatcggcgcggc
aagtacctgtggttgacactcaatacggctggggtccataggccgacggacaccgcactc
gtggtgcacctgggcatgagtgggcagatgctgctcggggcggtgccgtgtgccgctcac
gtccggatttccgcgctgctcgacgacgggaccgtgctgagcttcgctgaccaacggacc
ttcggagggtggctgcttgccgacctggtgacggtggacggcagcgtggtaccggtgccg
gtcgcccacctggcgcgcgacccgcttgacccgcggttcgattgtgacgctgtagttaaa
gtgttgcggcgcaagcattccgaactcaagcgccagctgctggatcagcgggtggtgtcg
ggaatcggcaacatctatgccgatgaggcgctgtggcgggccaaggtgaacggcgcccac
gtcgccgccacactaaggtgccggcgtctgggagcggtcctgcatgccgccgccgacgtg
atgcgcgaagcgctggcgaaaggtggcacctcgttcgactctttgtatgtcaacgtcaac
ggcgagtcgggctacttcgagcggtcgctggacgcttatggccgcgaaggcgaaaactgt
cggcgctgcggcgcggtgatacgccgggagaggtttatgaaccgctcgtcgttctactgc
ccgcgatgccagccgcggccccgaaagtag

DBGET integrated database retrieval system